GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISRCFHRKYRIPADVDPLTITSSLSSDGVLTVN
GPRKQV
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4m5s:A | 87 | 86 | 0.9884 | 0.9770 | 0.9884 | 6.20e-58 | 4m5t:A, 4m5t:C, 4m5t:E, 4m5t:G |
2 | 3l1e:A | 105 | 82 | 0.5581 | 0.4571 | 0.5854 | 4.19e-33 | |
3 | 6gjh:F | 87 | 81 | 0.5581 | 0.5517 | 0.5926 | 8.51e-32 | 6gjh:D, 6gjh:H, 6gjh:B, 4mjh:A, 4mjh:C |
4 | 5lum:A | 78 | 73 | 0.5349 | 0.5897 | 0.6301 | 1.32e-31 | 5lum:B, 5lum:D, 5lum:C, 5lum:E |
5 | 6f2r:Q | 89 | 75 | 0.3256 | 0.3146 | 0.3733 | 2.52e-14 | 6f2r:T, 6f2r:V |
6 | 5iov:B | 798 | 38 | 0.1628 | 0.0175 | 0.3684 | 2.9 | 5iou:B, 5iou:D, 5iov:D, 5un1:D, 5un1:H |
7 | 3msu:B | 426 | 27 | 0.0930 | 0.0188 | 0.2963 | 3.6 | 3msu:A |
8 | 7vbc:A | 1477 | 55 | 0.1628 | 0.0095 | 0.2545 | 4.5 | 7vba:A, 7vbb:A |
9 | 7obb:A | 1510 | 55 | 0.1628 | 0.0093 | 0.2545 | 4.5 | |
10 | 7ob9:A | 1535 | 55 | 0.1628 | 0.0091 | 0.2545 | 4.8 | 7oba:A |
11 | 4lvq:A | 319 | 33 | 0.1163 | 0.0313 | 0.3030 | 6.1 | 4lvq:B |
12 | 5hcc:A | 982 | 81 | 0.3023 | 0.0265 | 0.3210 | 7.7 | 7ad6:A, 8ayh:A, 1cfa:A, 5hcd:A, 5hce:A |