Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISRCFHRKYRIPADVDPLTITSSLSSDGVLTVN
GPRKQV

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4m5s:A 87 86 0.9884 0.9770 0.9884 6.20e-58 4m5t:A, 4m5t:C, 4m5t:E, 4m5t:G
2 3l1e:A 105 82 0.5581 0.4571 0.5854 4.19e-33
3 6gjh:F 87 81 0.5581 0.5517 0.5926 8.51e-32 6gjh:D, 6gjh:H, 6gjh:B, 4mjh:A, 4mjh:C
4 5lum:A 78 73 0.5349 0.5897 0.6301 1.32e-31 5lum:B, 5lum:D, 5lum:C, 5lum:E
5 6f2r:Q 89 75 0.3256 0.3146 0.3733 2.52e-14 6f2r:T, 6f2r:V
6 5iov:B 798 38 0.1628 0.0175 0.3684 2.9 5iou:B, 5iou:D, 5iov:D, 5un1:D, 5un1:H
7 3msu:B 426 27 0.0930 0.0188 0.2963 3.6 3msu:A
8 7vbc:A 1477 55 0.1628 0.0095 0.2545 4.5 7vba:A, 7vbb:A
9 7obb:A 1510 55 0.1628 0.0093 0.2545 4.5
10 7ob9:A 1535 55 0.1628 0.0091 0.2545 4.8 7oba:A
11 4lvq:A 319 33 0.1163 0.0313 0.3030 6.1 4lvq:B
12 5hcc:A 982 81 0.3023 0.0265 0.3210 7.7 7ad6:A, 8ayh:A, 1cfa:A, 5hcd:A, 5hce:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218