GMQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRPLEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVT
PDLGVVSDTFWRLPNVKRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLALAELM
AKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGHAFARLIRSRDIVATALGQLGRDPLIF
LHPPEAGCEECDAARQSI
The query sequence (length=258) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6mn5:D | 260 | 257 | 0.9961 | 0.9885 | 1.0000 | 0.0 | 6mn3:A, 6mn3:B, 6mn4:A, 6mn4:B, 6mn4:C, 6mn4:D, 6mn4:E, 6mn4:F, 6mn5:A, 6mn5:B, 6mn5:C, 6mn5:E, 6mn5:F |
2 | 3kzl:A | 266 | 239 | 0.2713 | 0.2632 | 0.2929 | 6.62e-30 | 3ijw:A, 3ijw:B, 3kzl:D, 3kzl:C, 3kzl:B, 3n0m:A, 3n0m:B, 3n0s:A, 3n0s:D, 3n0s:C, 3n0s:B, 3slb:A, 3slb:D, 3slb:C, 3slb:B, 3slf:A, 3slf:B |
3 | 6bc2:A | 268 | 264 | 0.3450 | 0.3321 | 0.3371 | 6.34e-28 | 6bbz:A, 6bc3:A, 6bc4:A, 6bc5:A, 6bc7:A, 6np2:A, 6np3:A, 6np4:A, 6np5:A, 6nti:A, 6ntj:A, 6o5u:A |
4 | 3sma:B | 268 | 249 | 0.3333 | 0.3209 | 0.3454 | 1.06e-24 | 3sma:A, 3sma:C, 3sma:D |
5 | 2nyg:A | 270 | 248 | 0.2791 | 0.2667 | 0.2903 | 4.94e-19 | 2nyg:B, 2nyg:C, 2nyg:D, 2nyg:E |
6 | 7q1d:D | 272 | 250 | 0.3062 | 0.2904 | 0.3160 | 1.23e-18 | 7mqk:A, 7mqk:B, 7mqk:C, 7mqk:D, 7mql:A, 7mql:B, 7mql:C, 7mql:D, 7mqm:A, 7mqm:B, 7mqm:C, 7mqm:D, 7q0q:A, 7q0q:B, 7q10:A, 7q1d:A, 7q1d:B, 7q1d:C, 7q1x:A |
7 | 5ht0:C | 261 | 250 | 0.2984 | 0.2950 | 0.3080 | 5.12e-17 | 5ht0:A, 5ht0:B, 5ht0:D, 5ht0:E, 5ht0:F, 7kes:A, 7kes:B, 6mn0:A, 6mn0:B, 6mn0:C, 6mn0:F, 6mn0:D, 6mn0:E, 6mn1:A, 6mn1:B, 6mn2:A, 6mn2:B |
8 | 6mb6:A | 268 | 162 | 0.2209 | 0.2127 | 0.3519 | 4.28e-12 | 6mb4:B, 6mb5:A, 6mb6:C, 6mb7:A, 6mb9:A, 6mb9:B, 6mb9:D, 6mb9:C |
9 | 8bd3:6 | 217 | 40 | 0.0659 | 0.0783 | 0.4250 | 6.5 | 8bd3:0 |
10 | 6bh8:A | 371 | 65 | 0.0736 | 0.0512 | 0.2923 | 9.8 |