GMKSLHRPDLYSWSTFNPARNIDFNGFAWIRPEGNILIDPVALSNHDWKHLESLGGVVWIVLTNSDHVRSAKEIADQTYT
KIAGPVAEKENFPIYCDRWLSDGDELVPGLKVMELQGSKTPGELALLLEETTLITGDLVRAYRAGGLEILPDEKLMNKQK
VVASVRRLAALEKVEAVLVGDGWSVFRDGRDRLKELVATLA
The query sequence (length=201) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2p97:A | 201 | 201 | 1.0000 | 1.0000 | 1.0000 | 4.53e-148 | 2p97:B |
2 | 2xf4:A | 210 | 106 | 0.1642 | 0.1571 | 0.3113 | 6.71e-05 | |
3 | 6n36:A | 265 | 178 | 0.2687 | 0.2038 | 0.3034 | 8.86e-04 | |
4 | 6z1p:Au | 169 | 83 | 0.0995 | 0.1183 | 0.2410 | 3.0 | |
5 | 6t5e:A | 439 | 57 | 0.0896 | 0.0410 | 0.3158 | 3.7 | |
6 | 8ivz:A | 165 | 36 | 0.0697 | 0.0848 | 0.3889 | 3.8 | 8ivz:B |
7 | 4n4j:A | 497 | 57 | 0.0896 | 0.0362 | 0.3158 | 4.3 | 4n4k:A, 4n4l:A, 4n4m:A, 4rwm:A |
8 | 6yak:AAA | 282 | 94 | 0.1294 | 0.0922 | 0.2766 | 6.1 | 6yak:CCC |