BioLiP

>protein
GMKLGVNLCFAVKRWLEPDRLAGLVRDDLGLEYVQYTYDLTDPWWPDIERDRRAIAYAKAFRKAGLTIESTFGGLASYTY
NHFLAPTLELQSLGYQHLKRAIDMTAAMEVPATGMPFGSYSAADALNPARREEIYAIARDMWIELAAYAKRQGLSMLYVE
PVPLATEFPSSAADAARLMADLDGRTEIPVRLLVDWGHALFEPLFGPEADMDHWMDLCQPWIAAYHIQQTDGQLDRHWSF
TQPGVVTPQRLQDFWDKYALTDQTFFAEILYPFEARDEDVLADMIASVKALKAASPA

The query sequence (length=297) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3qxb:A	297	297	1.0000	1.0000	1.0000	0.0	3qxb:B, 3qxb:C, 3qxb:D
2	6vbz:A	256	75	0.0673	0.0781	0.2667	1.9	6vbz:B
3	9bha:A	793	92	0.0875	0.0328	0.2826	2.4	5a9f:A, 5aga:A, 9bh8:A, 9bh8:B, 9bh9:A, 9bh9:B, 9bha:B, 9c5q:C, 9c5q:A
4	3nsj:A	530	59	0.0539	0.0302	0.2712	3.0	7pag:A, 5ug7:A, 4y1s:A, 4y1t:A
5	5zq6:A	828	183	0.1549	0.0556	0.2514	3.6	5zq4:B, 5zq4:A, 5zq6:C, 5zq7:A, 5zq7:C
6	7cu1:A	535	55	0.0539	0.0299	0.2909	6.9	8ad7:A, 8ad8:A, 7aqu:A, 7aqu:B, 7cu0:A, 7cu0:B, 7cu1:B, 7cu2:A, 7cu2:B, 6h44:A, 6h44:B, 6sls:A, 6sls:B, 6slt:A, 6slt:B
7	8iab:A	704	57	0.0572	0.0241	0.2982	7.4	8iab:B, 8iad:A, 8iad:B, 7xa9:A, 7xa9:B
8	3ayv:D	244	27	0.0370	0.0451	0.4074	7.6	3ayt:A, 3ayt:B, 3ayt:C, 3ayt:D, 3ayv:A, 3ayv:B, 3ayv:C
9	6l5t:A	234	40	0.0370	0.0470	0.2750	8.8

[Back]