BioLiP

>protein
GMILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPNFVMRLFTVEPGGLIDRASHPWEEEIFVLKGKLTVLKEQGEETVE
EGFYIFVEPNEIHGFRNDTDSEVEWLCLIPKEGGE

The query sequence (length=115) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8hjx:A	118	115	0.9913	0.9661	0.9913	2.52e-80	8hjx:B, 8hjy:A, 8hjy:B, 8hjz:A, 8hjz:B, 6l2d:A, 6l2d:B, 6l2e:A, 6l2e:B, 6l2f:A, 6l2f:B, 1vj2:A, 1vj2:B, 5wse:A, 5wse:B, 5wse:C, 5wse:D, 5wsf:A, 5wsf:B, 5wsf:C, 5wsf:D, 8zyg:A, 8zyg:B, 8zyh:A, 8zyh:B
2	3ht2:A	143	115	0.3391	0.2727	0.3391	1.55e-08	3ht2:C
3	5tg0:A	137	100	0.2174	0.1825	0.2500	2.77e-04	6a53:A, 6a53:B, 6a54:A, 6a54:B, 6a55:A, 6a55:B, 8hlf:A, 8hlf:B, 5tfz:A, 5tfz:B
4	3ibm:B	146	91	0.2000	0.1575	0.2527	7.10e-04	3ibm:A
5	3jzv:A	148	104	0.2087	0.1622	0.2308	0.026
6	3kgz:A	145	77	0.1652	0.1310	0.2468	0.030	3kgz:B
7	2h0v:A	335	62	0.1217	0.0418	0.2258	0.79	2h0v:B, 8hfb:A, 8hfb:B, 1y3t:A, 1y3t:B
8	7cpx:A	2262	35	0.1043	0.0053	0.3429	1.7	7cpx:B, 7cpy:A, 7cpy:B
9	5cw2:C	319	47	0.1304	0.0470	0.3191	2.0	5cw2:A, 5cw2:B, 5cw2:D
10	3cew:A	118	61	0.1391	0.1356	0.2623	3.4	3cew:B, 3cew:C, 3cew:D
11	1bda:A	265	22	0.0870	0.0377	0.4545	3.5	1a5h:A, 1a5h:B, 1bda:B, 1rtf:B
12	5bpx:A	153	47	0.1217	0.0915	0.2979	4.8	4p9g:A
13	6l4c:C	353	63	0.1739	0.0567	0.3175	5.0
14	5u57:A	190	48	0.1391	0.0842	0.3333	5.4	5u55:A, 5u55:B, 5u55:C, 5u55:D, 5u57:B, 5u57:C, 5u57:D, 5u58:A, 5u58:B, 5u58:C, 5u5d:A, 5u5d:B, 5u5d:D
15	6l4c:B	373	63	0.1739	0.0536	0.3175	6.0	6l4c:A
16	4zpl:A	316	31	0.0957	0.0348	0.3548	8.8
17	6r77:A	348	67	0.1739	0.0575	0.2985	9.2	6r77:B

[Back]