GMDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYVIDSIVRQSRHQFGT
DKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQPLLDMAAGT
The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6xkb:C | 139 | 139 | 1.0000 | 1.0000 | 1.0000 | 6.57e-102 | 6xkb:B, 6xkb:A, 6xkb:E, 6xkb:D |
2 | 3d9k:B | 141 | 137 | 0.7986 | 0.7872 | 0.8102 | 1.25e-79 | 3d9k:A, 3d9l:A, 3d9l:B, 3d9m:A, 3d9m:B, 3d9n:A, 3d9n:B, 3d9o:B, 3d9p:A, 3d9p:B |
3 | 2mow:A | 161 | 141 | 0.2446 | 0.2112 | 0.2411 | 2.95e-06 | 6gc3:A, 2lo6:A, 6o3w:A, 6o3w:B, 6o3x:A, 6o3x:B, 6o3x:C, 6o3y:A, 6o3y:B, 6o3y:C |
4 | 4jxt:A | 130 | 94 | 0.1655 | 0.1769 | 0.2447 | 2.51e-05 | |
5 | 1sza:B | 140 | 97 | 0.1871 | 0.1857 | 0.2680 | 2.96e-05 | 2bf0:X |
6 | 4q94:A | 129 | 94 | 0.1655 | 0.1783 | 0.2447 | 7.81e-04 | 9b9l:A, 4q94:B, 4q96:A, 4q96:B, 4q96:D, 4q96:E |
7 | 8a7d:Q | 273 | 63 | 0.1439 | 0.0733 | 0.3175 | 1.7 | |
8 | 1dli:A | 402 | 108 | 0.1727 | 0.0597 | 0.2222 | 1.9 | 1dlj:A |
9 | 2h4z:A | 255 | 67 | 0.1439 | 0.0784 | 0.2985 | 2.6 | 2f90:A, 2f90:B, 2h4z:B, 2hhj:A, 2hhj:B, 7n3r:B, 7n3s:A, 7n3s:B, 7thi:A, 7thi:B |
10 | 5f7v:A | 388 | 40 | 0.0791 | 0.0284 | 0.2750 | 3.7 | |
11 | 6njy:A | 237 | 68 | 0.1223 | 0.0717 | 0.2500 | 5.3 | 6njy:B |
12 | 6ks6:g | 520 | 47 | 0.1223 | 0.0327 | 0.3617 | 6.1 | 6ks6:G, 4v81:C, 4v81:k, 4v8r:AG, 4v8r:Ag, 4v8r:BG, 4v8r:Bg, 4v94:C, 4v94:K, 4v94:c, 4v94:k, 7ylw:G, 7ylw:g, 7ylx:G, 7ylx:g, 7yly:G, 7yly:g |
13 | 5mmj:w | 82 | 34 | 0.0863 | 0.1463 | 0.3529 | 7.3 | 5mmm:w |
14 | 1gpm:A | 501 | 92 | 0.1439 | 0.0399 | 0.2174 | 7.9 | 1gpm:B, 1gpm:C, 1gpm:D |
15 | 4js4:A | 468 | 78 | 0.1511 | 0.0449 | 0.2692 | 8.4 | 3c94:A, 4hcb:A, 4hcb:B, 4hcc:A, 4hcc:B, 3hl8:A, 3hp9:A, 4jrp:A, 4jrp:B, 4jrq:A, 4jrq:B, 4js4:B, 4js5:A, 4js5:B |
16 | 2qxf:A | 433 | 78 | 0.1511 | 0.0485 | 0.2692 | 9.0 |