GMAFMEKIFPDILEAIRNEEIIKESKKIPMPYFGLFALVIFDKVKGSETSLYEIGEEFGKMLSPKNIEELKKIFKLMNFG
DLEIDENKILLKNPPYKIKLSNPPYQWVSKEEPIHDFIAGILAGCLEEIFYYYFVVNEVECVSQGKDKCVFEVKEVD
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2oso:A | 157 | 157 | 1.0000 | 1.0000 | 1.0000 | 1.92e-110 | 2osd:A |
| 2 | 3naz:C | 613 | 41 | 0.0828 | 0.0212 | 0.3171 | 4.8 | 3naz:D, 3o3c:A, 3o3c:B, 3o3c:C, 3o3c:D, 3rsz:C, 3rsz:D, 3rsz:A, 3rsz:B |
| 3 | 3nb0:C | 646 | 41 | 0.0828 | 0.0201 | 0.3171 | 4.8 | 4kq1:A, 4kq1:B, 4kq1:C, 4kq1:D, 4kq2:A, 4kq2:B, 4kq2:C, 4kq2:D, 4kqm:A, 4kqm:B, 4kqm:C, 4kqm:D, 3nb0:A, 3nb0:B, 3nb0:D, 3rt1:A, 3rt1:C, 3rt1:D, 3rt1:B, 5suk:A, 5suk:B, 5suk:C, 5suk:D, 5sul:A, 5sul:B, 6u77:A, 6u77:B, 6u77:C, 6u77:D, 5uw0:A, 5uw0:B, 5uw0:C, 5uw0:D, 5uw1:A, 5uw1:B, 5uw1:C, 5uw1:D, 5uw4:C, 5uw4:B, 5uw4:A, 5uw4:D, 5ux7:A, 5ux7:B, 5ux7:C, 5ux7:D, 5vnc:A, 5vnc:B, 5vnc:C, 5vnc:D |
| 4 | 8tvi:A | 513 | 25 | 0.0701 | 0.0214 | 0.4400 | 5.1 | 8tvi:B, 8tvi:C, 8tvi:D |
| 5 | 6co7:A | 1061 | 64 | 0.0892 | 0.0132 | 0.2188 | 6.3 | 6co7:B, 6co7:C, 6co7:D |
| 6 | 2v95:A | 342 | 74 | 0.1019 | 0.0468 | 0.2162 | 7.1 | |
| 7 | 7e2i:D | 907 | 28 | 0.0573 | 0.0099 | 0.3214 | 7.6 | 7e2g:D, 7e2h:E |
| 8 | 1bk9:A | 124 | 44 | 0.0892 | 0.1129 | 0.3182 | 8.9 | 1m8r:A, 1m8s:A, 1psj:A |
| 9 | 8re3:A | 445 | 23 | 0.0573 | 0.0202 | 0.3913 | 9.9 | 8re2:A, 8re3:B |
umich.edu