BioLiP

>protein
GLYVGGFVDVVSCPLEQELYLDPDQVTDYLPVTEPLPITIEHLPETEVGWTLGLFQVSHGIFCTGAITSPAFLELASRLA
DTSHVARAPVKNLPKEPLLEILHTWLPGLSLSSIHPRELSQTPSGPVFQHVSLCALGRRRGTVAVYGHDAEWVVSRFSSV
SKSERAHILQHVSSCRLEDLSTPNFVSPLE

The query sequence (length=190) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2pbk:A	228	191	1.0000	0.8333	0.9948	5.13e-137	3njq:A, 3njq:B, 4p2t:A, 4p2t:B, 4p3h:A, 4p3h:B, 2pbk:B, 5ur3:A, 5ur3:B, 5ute:A, 5ute:B, 5utn:A, 5utn:B, 5uv3:A, 5uv3:B, 5uvp:A, 5uvp:B, 5v5d:A, 5v5d:B, 5v5e:A, 5v5e:B
2	1o6e:B	232	181	0.4211	0.3448	0.4420	7.12e-44	1o6e:A
3	1nju:A	230	168	0.3632	0.3000	0.4107	1.76e-31	8j3s:A, 8j3s:B, 8j3s:C, 8j3t:A, 8j3t:B, 1jq7:A, 1jq7:B, 1njt:A, 1njt:B, 1njt:C, 1njt:D, 1nju:B, 1nju:C, 1nju:D, 1nkk:A, 1nkk:B, 1nkk:C, 1nkk:D, 1nkm:A, 7tcz:A, 2wpo:A, 2wpo:B, 2wpo:C, 2wpo:D
4	1at3:A	217	164	0.2684	0.2350	0.3110	3.16e-18	1at3:B
5	4v08:B	224	174	0.2842	0.2411	0.3103	7.88e-18	4v08:A
6	6y0f:C	722	32	0.0737	0.0194	0.4375	3.4	6y0f:A, 6y0f:B, 6y0f:D
7	4bxw:B	287	65	0.0842	0.0557	0.2462	4.3	4bxw:A
8	5o36:A	178	36	0.0737	0.0787	0.3889	5.1	5o19:A
9	6rre:D	427	68	0.1158	0.0515	0.3235	9.5	4iik:A, 6rp4:A, 6rp4:B, 6rp4:C, 6rp4:D, 6rre:B, 6rre:C
10	2vbi:A	554	55	0.1000	0.0343	0.3455	9.9	2vbi:B, 2vbi:C, 2vbi:D, 2vbi:E, 2vbi:F, 2vbi:G, 2vbi:H

[Back]