BioLiP

>protein
GLYLQVGAFANPDAAELLKAKLSGVTAAPVFISSVVRNQQILHRVRLGPIGSADEVSRTQDSIRVANLGQPTLVRPD

The query sequence (length=77) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6i09:A	77	77	1.0000	1.0000	1.0000	3.28e-51	6i0a:A, 6i0n:A
2	2cc0:A	192	34	0.1948	0.0781	0.4412	0.099	2cc0:B
3	4oht:A	455	39	0.1558	0.0264	0.3077	0.11	4oht:B, 4ywu:A, 4ywu:B, 4ywv:A, 4ywv:B
4	4ysm:A	475	64	0.2468	0.0400	0.2969	1.9	3ma6:A, 3ma6:B, 4ysj:A, 4ysj:B, 4ysm:B, 4yuq:A, 4yuq:B, 4yzb:A, 4yzb:B
5	8b0e:AAA	440	39	0.1818	0.0318	0.3590	2.0	8b0d:AAA, 7psj:A
6	3vnz:A	466	39	0.1818	0.0300	0.3590	2.3	5g0m:A, 5g0q:A, 5l77:A, 8ogx:A, 8oht:AAA, 8ohu:AAA, 8ohv:AAA, 7psi:A, 7psk:A, 3vo0:A
7	2e9f:B	450	27	0.1688	0.0289	0.4815	3.6	2e9f:A, 2e9f:D, 2e9f:C
8	3iwj:A	500	44	0.1688	0.0260	0.2955	4.3	3iwj:B
9	5v8f:7	725	54	0.1818	0.0193	0.2593	4.7	8b9a:7, 8b9b:7, 8b9c:7, 3jc6:7, 3jc7:7, 8kg6:7, 8kg8:7, 8p5e:7, 8p62:7, 8p63:7, 7pt6:7, 7pt6:G, 7pt7:7, 7pt7:G, 7qhs:7, 6rqc:7, 6sko:7, 8w7m:7, 7z13:7, 7z13:f
10	5mwk:A	1040	16	0.1299	0.0096	0.6250	5.0	5mqm:A, 5mqn:A
11	3iwk:H	497	44	0.1558	0.0241	0.2727	5.7	3iwk:A, 3iwk:B, 3iwk:C, 3iwk:D, 3iwk:E, 3iwk:F, 3iwk:G, 3iwk:I, 3iwk:J, 3iwk:K, 3iwk:L
12	6hvg:A	1278	86	0.2857	0.0172	0.2558	6.8	6hvg:B, 6syq:A, 6syq:B, 6szi:A, 6szi:B, 6t16:B, 6t16:A, 6t18:A, 6t18:B, 6t1p:A, 6t1p:B
13	7el9:A	1731	37	0.1818	0.0081	0.3784	7.2	7el9:D, 7elc:A
14	7elb:A	1937	37	0.1818	0.0072	0.3784	7.2	7ckm:A, 7elb:C, 6kld:A, 6kle:A, 6klh:A, 6klh:C
15	6kki:A	366	44	0.2078	0.0437	0.3636	7.7

[Back]