GLTIYFKKPDSWGTPHLYYYDTNPKVDEPTWSEAPEMEHYEGDWYTHTIEGVESVRLLFKDRGTNQWPGPGEPGFFRDQD
GWFDGEWHVDRP
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2c3h:B | 94 | 92 | 1.0000 | 0.9787 | 1.0000 | 4.23e-65 | 2c3h:A, 2c3h:H, 2c3h:C, 2c3h:D, 2c3h:E, 2c3h:F, 2c3h:G |
2 | 1xdq:C | 264 | 31 | 0.1413 | 0.0492 | 0.4194 | 0.93 | 1xdq:A, 1xdq:B, 1xdq:D, 1xdq:E |
3 | 3rsc:A | 397 | 18 | 0.1304 | 0.0302 | 0.6667 | 1.4 | 3iaa:A, 3iaa:B, 3rsc:B |
4 | 4dz6:A | 168 | 68 | 0.1957 | 0.1071 | 0.2647 | 1.5 | 4dz6:B, 4dz6:C, 4dz6:D, 4dz6:E, 4dz6:F |