GLRQPAPFSDEIEVDFSKPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTH
NFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEG
ISTSDIITRIVRDYDVY
The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4mvd:B | 253 | 177 | 1.0000 | 0.6996 | 1.0000 | 8.44e-135 | 3hl4:A, 3hl4:B, 4mvc:A, 4mvc:B, 4mvd:A, 4mvd:D, 4mvd:C, 4mvd:F, 4mvd:E, 4mvd:H, 4mvd:G |
| 2 | 4zcs:A | 141 | 140 | 0.4068 | 0.5106 | 0.5143 | 3.76e-53 | 7pui:A, 7pve:A, 7pvf:A, 7pvg:A, 7py9:A, 7pya:A, 7pyb:A, 7pyc:A, 7q2i:A, 7q2k:A, 7q2l:A, 7q2m:A, 7q2v:A, 7q3m:A, 7q3w:A, 7q9v:A, 7q9w:A, 7qa7:A, 7qad:A, 7qd3:A, 7qvn:A, 7qvo:A, 7z9v:A, 4zcp:A, 4zcq:A, 4zcr:A, 4zcs:C, 4zcs:E, 4zcs:B, 4zcs:D, 4zcs:F |
| 3 | 4xsv:A | 306 | 137 | 0.3220 | 0.1863 | 0.4161 | 1.95e-27 | 3elb:A |
| 4 | 4xsv:A | 306 | 138 | 0.2768 | 0.1601 | 0.3551 | 5.35e-19 | 3elb:A |
| 5 | 1coz:A | 126 | 140 | 0.2712 | 0.3810 | 0.3429 | 6.35e-12 | 1coz:B, 1n1d:A, 1n1d:B, 1n1d:C, 1n1d:D |
| 6 | 3glv:B | 122 | 70 | 0.1243 | 0.1803 | 0.3143 | 1.58e-05 | |
| 7 | 5x3d:A | 126 | 98 | 0.1808 | 0.2540 | 0.3265 | 0.005 | |
| 8 | 7zc6:A | 191 | 83 | 0.1299 | 0.1204 | 0.2771 | 0.33 | |
| 9 | 4z9n:B | 324 | 31 | 0.0734 | 0.0401 | 0.4194 | 0.62 | 4z9n:A, 4z9n:C, 4z9n:D, 4z9n:E, 4z9n:F |
| 10 | 5l4g:L | 389 | 61 | 0.0904 | 0.0411 | 0.2623 | 0.78 | 5gjq:L, 5gjr:L, 5gjr:z, 5m32:f, 6msb:E, 6msd:E, 6mse:E, 6msg:E, 6msh:E, 6msj:E, 7qxn:E, 7qxp:E, 7qxu:E, 7qxw:E, 7qxx:E, 7qy7:E, 7qya:E, 5t0c:AE, 5t0c:BE, 5t0g:E, 5t0h:E, 5t0i:E, 5t0j:E, 5vfp:E, 5vfr:E, 5vfs:E, 7w37:E, 7w38:E, 7w39:E, 7w3a:E, 7w3b:E, 7w3c:E, 7w3f:E, 7w3i:E, 7w3j:E, 7w3k:E, 7w3m:E, 6wjd:E, 6wjn:E |
| 11 | 1mpa:H | 225 | 36 | 0.0734 | 0.0578 | 0.3611 | 2.8 | 2mpa:H |
| 12 | 6nrz:A | 517 | 73 | 0.1073 | 0.0368 | 0.2603 | 5.4 | 6nrz:B, 6ns0:A, 6ns0:B, 6o3f:A, 6o3f:B |
| 13 | 8h2w:B | 984 | 88 | 0.1073 | 0.0193 | 0.2159 | 5.4 | 8h2w:A, 5nz8:B |
| 14 | 3mia:A | 325 | 31 | 0.0791 | 0.0431 | 0.4516 | 7.3 | 4bcf:A, 4bcg:A, 4bch:A, 4bci:A, 4bcj:A, 3blq:A, 3blr:A, 6gzh:A, 8i0l:A, 4imy:A, 4imy:C, 4imy:E, 8k5r:A, 3lq5:A, 3my1:A, 7nwk:A, 4ogr:A, 4ogr:E, 4ogr:I, 3tn8:A, 6w9e:A, 6z45:A |
| 15 | 2wc5:A | 141 | 78 | 0.1073 | 0.1348 | 0.2436 | 10.0 | 2wc6:A, 2wch:A, 2wcj:A, 2wcl:A, 2wcm:A |
umich.edu