BioLiP

>protein
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAE
EIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQ
STVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ

The query sequence (length=238) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1aym:3	238	238	1.0000	1.0000	1.0000	0.0	1ayn:3, 1c8m:3, 1ncr:C, 1nd2:C, 1nd3:C, 1qju:3, 1qjx:3, 1qjy:3
2	2hwd:3	238	238	0.8151	0.8151	0.8151	3.67e-144	2hwe:3, 2hwf:3, 1r1a:3
3	8ay4:C	237	238	0.7311	0.7342	0.7311	1.14e-135	3dpr:C, 1fpn:3, 1v9u:3
4	6sk7:C	214	214	0.6891	0.7664	0.7664	2.30e-130
5	9fjc:3	238	233	0.4916	0.4916	0.5021	9.15e-91
6	6zck:C	238	233	0.5000	0.5000	0.5107	1.14e-89
7	8ayx:C	238	228	0.5000	0.5000	0.5219	1.66e-86	8ayy:C, 5o5b:3, 5o5p:3
8	5osn:C	243	243	0.5210	0.5103	0.5103	1.16e-83	6t48:C, 6t4c:C
9	8ayz:C	235	228	0.4832	0.4894	0.5044	1.51e-83	1eah:3
10	6gzv:C	238	233	0.4664	0.4664	0.4764	3.47e-83	6zcl:C
11	5bnn:C	247	231	0.4496	0.4332	0.4632	1.14e-75	5bno:C, 5bnp:C, 6crp:B, 6cs3:B, 6cv1:B, 6cvb:B, 7ebr:B, 6mzi:B, 6wdt:C
12	6ppo:B	235	232	0.4496	0.4553	0.4612	3.97e-75	6psf:B
13	4aed:C	242	241	0.4328	0.4256	0.4274	3.95e-65
14	1z7z:3	192	186	0.3697	0.4583	0.4731	5.42e-62
15	5cfc:B	232	189	0.2647	0.2716	0.3333	1.63e-33	5cfd:B
16	1tme:3	230	198	0.2899	0.3000	0.3485	3.96e-32
17	5nem:3	220	230	0.2437	0.2636	0.2522	1.22e-21
18	4ctf:D0	226	234	0.2899	0.3053	0.2949	4.16e-21	4ctf:D3, 4ctf:D1, 4ctf:DZ, 4ctf:D2, 4ctf:D4, 4ctf:D7, 4ctf:D5, 4ctf:D8, 4ctf:D6, 4ctf:D9, 4ctf:Dc, 4ctf:DA, 4ctf:DD, 4ctf:DB, 4ctf:DE, 4ctf:DC, 4ctf:DF, 4ctf:DI, 4ctf:DG, 4ctf:DJ, 4ctf:DH, 4ctf:DK, 4ctf:DN, 4ctf:DL, 4ctf:DO, 4ctf:DM, 4ctf:DP, 4ctf:DS, 4ctf:DQ, 4ctf:DT, 4ctf:DR, 4ctf:DU, 4ctf:DX, 4ctf:DV, 4ctf:DY, 4ctf:DW, 4ctf:Da, 4ctf:Dd, 4ctf:Db, 4ctf:De, 4ctf:Dh, 4ctf:Df, 4ctf:Di, 4ctf:Dg, 4ctf:Dj, 4ctf:Dm, 4ctf:Dk, 4ctf:Dn, 4ctf:Dl, 4ctf:Do, 4ctf:Dr, 4ctf:Dp, 4ctf:Ds, 4ctf:Dq, 4ctf:EA, 4ctf:ED, 4ctf:EB, 4ctf:EE, 4ctf:EC, 2wff:3, 2ws9:3, 2xbo:3
19	8uux:B	515	92	0.1050	0.0485	0.2717	0.002	6c6q:A, 6c6q:B, 6e47:A, 6e47:B, 6e48:A, 6e48:B, 6h6l:A, 6h6l:B, 6h6l:C, 6h6l:D, 6h6m:A, 6h6m:B, 6h6m:C, 6h6m:D, 6p4j:A, 6p4j:B, 6p4j:C, 6p4k:A, 6p4k:B, 6p4k:C, 8uux:A, 8uv3:A, 8uv3:C, 6xw6:A, 6xw6:B, 6xw7:A, 6xw7:B, 6xw7:E, 6xw7:F
20	7tfk:A	360	41	0.0504	0.0333	0.2927	1.5	7tfl:A
21	8dr5:A	646	41	0.0504	0.0186	0.2927	1.8	8dqx:A, 8dqz:A, 8dr0:A, 8dr1:A, 8dr3:A, 8dr4:A, 8dr6:A, 8dr7:A, 1sxj:A, 7tfh:A, 7tfi:A, 7tfj:A, 7thj:A, 7thv:A, 7ti8:A, 7tib:A, 7tic:A, 7tid:A, 7tku:A, 7u19:A, 7u1a:A, 7u1p:A
22	8b2u:A	248	37	0.0420	0.0403	0.2703	2.9	8b1s:A, 1h2c:A, 1h2d:A, 1h2d:B, 7k5d:A, 7k5l:A
23	1io0:A	166	78	0.0840	0.1205	0.2564	4.6

[Back]