GLPVIGRVAADAPILAEQNIEESCRINPAFFNPRADYLLRVRGMSMKDIGILDGDLLAVHVTREARNGQVVVARIGEEVT
VKRFKREGSKVWLLAENPEFAPIEVDLKEQELIIEGLSVGVIRR
The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8b0v:A | 124 | 124 | 1.0000 | 1.0000 | 1.0000 | 2.43e-86 | 8b0v:B |
2 | 3jsp:A | 194 | 123 | 0.6532 | 0.4175 | 0.6585 | 7.79e-55 | 3jso:A, 3jso:B, 3jsp:B |
3 | 3bdn:A | 234 | 70 | 0.1694 | 0.0897 | 0.3000 | 0.25 | 3bdn:B, 2hnf:A, 2ho0:A, 1lli:A, 1lli:B, 1lmb:3, 1lmb:4, 1rio:A, 1rio:B |
4 | 2y0c:A | 461 | 112 | 0.2419 | 0.0651 | 0.2679 | 0.34 | 2y0c:B, 2y0c:C, 2y0c:D, 2y0d:A, 2y0d:B, 2y0d:C, 2y0d:D, 2y0e:A, 2y0e:B, 2y0e:C, 2y0e:D |
5 | 1tex:D | 247 | 45 | 0.1290 | 0.0648 | 0.3556 | 1.3 | 1tex:A, 1tex:B, 1tex:C |
6 | 5uid:A | 367 | 41 | 0.1129 | 0.0381 | 0.3415 | 3.2 | 5uid:D |
7 | 3kvo:B | 276 | 33 | 0.0887 | 0.0399 | 0.3333 | 3.6 | 3kvo:A |
8 | 3aql:B | 388 | 96 | 0.1935 | 0.0619 | 0.2500 | 4.6 | 3aqn:A, 3aqn:B |
9 | 4xqk:A | 1517 | 49 | 0.1290 | 0.0105 | 0.3265 | 6.3 | 4xqk:B |