BioLiP

>protein
GLPVFITPGSGQFLTTDDFQSPCALPWYHPTKEISIPGEVKNLVEICQVDSLVPINNTDTYINSENMYSVVLQSSINAPD
KIFSIRTDVASQPLATTLIGEISSYFTHWTGSLRFSFMFCGTANTTVKLLLAYTPPGIAEPTTRKDAMLGTHVIWDVGLQ
STISMVVPWISASHYRNTSPGRSTSGYITCWYQTRLVIPPQTPPTARLLCFVSGCKDFCLRMARDTNLHLQSGAIAQ

The query sequence (length=237) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ay4:C	237	237	1.0000	1.0000	1.0000	2.51e-179	3dpr:C, 1fpn:3, 1v9u:3
2	1aym:3	238	238	0.7342	0.7311	0.7311	1.13e-135	1ayn:3, 1c8m:3, 1ncr:C, 1nd2:C, 1nd3:C, 1qju:3, 1qjx:3, 1qjy:3
3	2hwd:3	238	238	0.7511	0.7479	0.7479	7.88e-135	2hwe:3, 2hwf:3, 1r1a:3
4	6sk7:C	214	214	0.5823	0.6449	0.6449	5.48e-111
5	9fjc:3	238	228	0.5105	0.5084	0.5307	4.99e-86
6	6zck:C	238	233	0.5063	0.5042	0.5150	2.96e-85
7	8ayx:C	238	239	0.5063	0.5042	0.5021	4.64e-84	8ayy:C, 5o5b:3, 5o5p:3
8	6gzv:C	238	228	0.4937	0.4916	0.5132	1.70e-83	6zcl:C
9	8ayz:C	235	228	0.4852	0.4894	0.5044	4.79e-82	1eah:3
10	5osn:C	243	243	0.5021	0.4897	0.4897	9.22e-81	6t48:C, 6t4c:C
11	5bnn:C	247	231	0.4641	0.4453	0.4762	4.53e-75	5bno:C, 5bnp:C, 6crp:B, 6cs3:B, 6cv1:B, 6cvb:B, 7ebr:B, 6mzi:B, 6wdt:C
12	6ppo:B	235	236	0.4177	0.4213	0.4195	3.23e-63	6psf:B
13	1z7z:3	192	187	0.3924	0.4844	0.4973	8.00e-62
14	4aed:C	242	243	0.4346	0.4256	0.4239	2.48e-61
15	1tme:3	230	200	0.2954	0.3043	0.3500	1.18e-31
16	5cfc:B	232	190	0.2743	0.2802	0.3421	5.72e-30	5cfd:B
17	4ctf:D0	226	196	0.2574	0.2699	0.3112	2.53e-23	4ctf:D3, 4ctf:D1, 4ctf:DZ, 4ctf:D2, 4ctf:D4, 4ctf:D7, 4ctf:D5, 4ctf:D8, 4ctf:D6, 4ctf:D9, 4ctf:Dc, 4ctf:DA, 4ctf:DD, 4ctf:DB, 4ctf:DE, 4ctf:DC, 4ctf:DF, 4ctf:DI, 4ctf:DG, 4ctf:DJ, 4ctf:DH, 4ctf:DK, 4ctf:DN, 4ctf:DL, 4ctf:DO, 4ctf:DM, 4ctf:DP, 4ctf:DS, 4ctf:DQ, 4ctf:DT, 4ctf:DR, 4ctf:DU, 4ctf:DX, 4ctf:DV, 4ctf:DY, 4ctf:DW, 4ctf:Da, 4ctf:Dd, 4ctf:Db, 4ctf:De, 4ctf:Dh, 4ctf:Df, 4ctf:Di, 4ctf:Dg, 4ctf:Dj, 4ctf:Dm, 4ctf:Dk, 4ctf:Dn, 4ctf:Dl, 4ctf:Do, 4ctf:Dr, 4ctf:Dp, 4ctf:Ds, 4ctf:Dq, 4ctf:EA, 4ctf:ED, 4ctf:EB, 4ctf:EE, 4ctf:EC, 2wff:3, 2ws9:3, 2xbo:3
18	5nem:3	220	226	0.2321	0.2500	0.2434	3.15e-19
19	8uux:B	515	82	0.0886	0.0408	0.2561	0.015	6c6q:A, 6c6q:B, 6e47:A, 6e47:B, 6e48:A, 6e48:B, 6h6l:A, 6h6l:B, 6h6l:C, 6h6l:D, 6h6m:A, 6h6m:B, 6h6m:C, 6h6m:D, 6p4j:A, 6p4j:B, 6p4j:C, 6p4k:A, 6p4k:B, 6p4k:C, 8uux:A, 8uv3:A, 8uv3:C, 6xw6:A, 6xw6:B, 6xw7:A, 6xw7:B, 6xw7:E, 6xw7:F
20	1io0:A	166	101	0.1055	0.1506	0.2475	0.56

[Back]