GLPPGPLENSSAKLVNDEAHPWKPLRPGDIRGPCPGLNTLASHGYLPRNGVATPAQIINAVQEGFNFDNQAAIFATYAAH
LVDGNLITDLLSIGRKTRLTGPDPPPPASVGGLNEHGTFEGDASMTRGDAFFGNNHDFNETLFEQLVDYSNRFGGGKYNL
TVAGELRFKRIQDSIATNPNFSFVDFRFFTAYGETTFPANLFVDGRRDDGQLDMDAARSFFQFSRMPDDFFRAPSPRSGT
GVEVVVQAHPMQPGRNVGKINSYTVDPTSSDFSTPCLMYEKFVNITVKSLYPNPTVQLRKALNTNLDFLFQGVAAGCTQV
FPYGR
The query sequence (length=325) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5oxt:A | 327 | 325 | 1.0000 | 0.9939 | 1.0000 | 0.0 | 8av5:A, 6ekw:A, 6ekx:A, 6eky:A, 6ekz:A, 6el0:A, 6el4:A, 5oxt:B, 5oxt:C, 5oxu:A, 5oy1:A, 5oy2:A, 7pn4:A, 7pn5:A, 7pn6:A, 7pn7:A, 7pn8:A, 7pn9:A, 7pna:A, 2yor:B, 2yor:A, 2yp1:A, 2yp1:B, 2yp1:C, 2yp1:D |
2 | 7zbp:A | 239 | 255 | 0.2554 | 0.3473 | 0.3255 | 2.43e-31 | 5fuj:A, 5fuj:B, 5fuk:A, 5fuk:B, 7zbp:B, 7zbp:C, 7zbp:D |
3 | 7znw:C | 235 | 209 | 0.2369 | 0.3277 | 0.3684 | 2.45e-29 | 7znm:A, 7znm:B, 7znv:A, 7znw:A |
4 | 7zcl:B | 227 | 178 | 0.1692 | 0.2423 | 0.3090 | 3.40e-20 | 7zcl:A |
5 | 7o2d:A | 228 | 219 | 0.1969 | 0.2807 | 0.2922 | 2.76e-19 | 7o1r:A, 7o1x:A, 7o1z:A, 7o2g:A |
6 | 8iag:B | 223 | 210 | 0.2000 | 0.2915 | 0.3095 | 3.33e-19 | 8iag:A |
7 | 2civ:A | 299 | 154 | 0.1292 | 0.1405 | 0.2727 | 2.47e-04 | 2ciw:A, 2cix:A, 2ciy:A, 2ciz:A, 2cj0:A, 2cj1:A, 2cj2:A, 1cpo:A, 2cpo:A, 2j18:A, 2j19:A, 2j5m:A, 7rst:A |
8 | 7sc6:A | 349 | 91 | 0.0800 | 0.0745 | 0.2857 | 0.22 | 7scq:A, 7scq:B |
9 | 4mgq:A | 159 | 68 | 0.0615 | 0.1258 | 0.2941 | 0.56 | |
10 | 2ctz:A | 421 | 37 | 0.0431 | 0.0333 | 0.3784 | 2.1 | 2ctz:B |
11 | 6bbn:E | 378 | 27 | 0.0462 | 0.0397 | 0.5556 | 5.1 | 2gry:A |
12 | 1px8:A | 500 | 59 | 0.0523 | 0.0340 | 0.2881 | 8.5 | 1px8:B, 1uhv:A, 1uhv:B, 1uhv:C, 1uhv:D |