GLIEVERKFAPGPDTEERLQELGATLEHRVTFRDTYYDTSELSLMLSDHWLRQREGSGWELKCPGVTGVSGPHNEYVEVT
SEAAIVAQLFELLGSGEQKPAGVAAVLGSLKLQEVASFITTRSSWKLAQLTIDLDSADFGYAVGEVEAMVHEKAEVPAAL
EKIITVSSMLGVPAQEEAPAKLMVYLQRFRPLDYQRLLEAASS
The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5a65:A | 208 | 206 | 0.9803 | 0.9567 | 0.9660 | 1.83e-141 | 5a64:A, 5a64:B, 5a65:B |
2 | 3tvl:A | 204 | 204 | 0.7488 | 0.7451 | 0.7451 | 1.87e-105 | 3tvl:B |
3 | 5xxu:R | 117 | 40 | 0.0788 | 0.1368 | 0.4000 | 3.7 | |
4 | 5wmm:A | 870 | 44 | 0.0837 | 0.0195 | 0.3864 | 7.3 |