GLHRLIYLSCATDGLSYPDLRDIMAKSEVNNLRDGITGMLCYGNGMFLQTLEGDRQKVSETYARILKDPRHHSAEIVEFK
AIEERTFINWSMRLVQLGEMDSDTIRRLRLKYSPAATFQPRSMTAEQCFRFLKELYDM
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8i98:F | 143 | 138 | 0.9928 | 0.9580 | 0.9928 | 1.64e-102 | 8i98:A, 8i98:B, 8i98:C, 8i98:D, 8i98:E, 8i98:G, 8i98:H, 8i98:I, 8i98:J, 8i98:K, 8i98:L, 8i98:M, 8i98:N, 8i98:O, 8i98:P, 8i98:Q, 8i98:R, 8i98:S, 8i98:T, 1x0p:A, 1x0p:B, 1x0p:C, 1x0p:D, 1x0p:E, 1x0p:F, 1x0p:G, 1x0p:H, 1x0p:I, 1x0p:J |
2 | 2hfo:A | 150 | 135 | 0.4275 | 0.3933 | 0.4370 | 6.06e-38 | 2hfn:A, 2hfn:B, 2hfn:C, 2hfn:D, 2hfn:E, 2hfn:F, 2hfn:G, 2hfn:H, 2hfn:I, 2hfn:J, 2hfo:B, 2hfo:C, 2hfo:D, 2hfo:E, 2hfo:F, 2hfo:G, 2hfo:H, 2hfo:I, 2hfo:J, 3mzi:A, 3mzi:B, 3mzi:C, 3mzi:D, 3mzi:E, 3mzi:F |
3 | 5m2a:A | 346 | 111 | 0.3043 | 0.1214 | 0.3784 | 2.15e-16 | 5m27:A, 5m27:B, 5m2a:B, 5mbb:A, 5mbb:B, 5mbc:A, 5mbc:B, 5mbd:A, 5mbd:B, 5mbe:A, 5mbe:B, 5mbh:A, 5mbj:A, 5mbk:A, 5nby:A |
4 | 2byc:A | 137 | 82 | 0.2536 | 0.2555 | 0.4268 | 4.87e-16 | 2byc:B |
5 | 2bun:A | 121 | 88 | 0.2536 | 0.2893 | 0.3977 | 1.43e-15 | |
6 | 4hh0:A | 383 | 88 | 0.2536 | 0.0914 | 0.3977 | 7.63e-14 | 4hh0:B, 4hh1:A, 4hh1:B, 2iyg:A, 2iyg:B, 2iyi:A, 2iyi:B, 1yrx:A, 1yrx:B, 1yrx:C |
7 | 6w6z:A | 151 | 118 | 0.2754 | 0.2517 | 0.3220 | 1.66e-13 | 6w72:A, 6w72:B |
8 | 4yut:A | 351 | 112 | 0.2754 | 0.1083 | 0.3393 | 2.81e-12 | 8qfe:A, 8qff:A, 8qfg:A, 8qfh:A, 8qfi:A, 8qfj:A, 5x4t:A, 5x4u:A, 5x4v:A, 4yus:A, 4yut:B |
9 | 3gfx:B | 394 | 132 | 0.2609 | 0.0914 | 0.2727 | 8.59e-07 | 3gfx:A, 3gfz:A, 3gfz:B, 3gg0:A, 3gg0:B, 3gg1:A, 3gg1:B, 2kb2:A |
10 | 3gfy:B | 374 | 132 | 0.2681 | 0.0989 | 0.2803 | 8.99e-07 | 3gfy:A |
11 | 4mlg:G | 324 | 97 | 0.1957 | 0.0833 | 0.2784 | 1.2 | 4mlg:A, 4mlg:B, 4mlg:C, 4mlg:D, 4mlg:E, 4mlg:F, 4mlg:H, 4mlg:I, 4mlg:J, 4mlg:K, 4mlg:L |
12 | 7vcf:F | 402 | 54 | 0.1232 | 0.0423 | 0.3148 | 5.0 | 7xzi:9, 7xzj:9 |
13 | 5iu2:B | 313 | 38 | 0.0942 | 0.0415 | 0.3421 | 6.4 | 5iu2:A, 4y83:A, 4y83:B, 4y83:C, 4y85:A, 4y85:B, 4y85:C |
14 | 2oaa:B | 248 | 95 | 0.1304 | 0.0726 | 0.1895 | 7.5 | 2oaa:A |
15 | 3l22:A | 429 | 24 | 0.0725 | 0.0233 | 0.4167 | 7.6 |