GLDRNRQDIGYVLGRLFAVLEKIQAEANPGLNATIADRYFGSASSTPIAVFGTLMRLLPHHLNKLEFEGRAVQLQWEIRQ
ILEHCQRFPNHLNLEQQGLFAIGYYHETQFLFTKDALKNLFNEA
The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8g9t:K | 582 | 124 | 1.0000 | 0.2131 | 1.0000 | 2.56e-86 | 8g9s:K, 8g9u:H, 8g9u:I, 8g9u:G, 8g9u:J, 8gam:H, 8gan:H, 8gan:G, 8gan:I, 8gan:J |
2 | 8dfs:I | 555 | 116 | 0.4355 | 0.0973 | 0.4655 | 5.00e-27 | 8dej:J, 8dej:K, 8dex:I, 8dfa:I, 8dfa:J, 8dfo:I |
3 | 8dej:I | 535 | 117 | 0.4435 | 0.1028 | 0.4701 | 4.32e-26 | |
4 | 7kha:I | 385 | 121 | 0.4355 | 0.1403 | 0.4463 | 2.98e-25 | |
5 | 7m3k:A | 587 | 112 | 0.2016 | 0.0426 | 0.2232 | 0.12 | |
6 | 2ffl:A | 732 | 69 | 0.1855 | 0.0314 | 0.3333 | 2.1 | 2ffl:B, 2ffl:C, 2ffl:D, 2qvw:A, 2qvw:B, 2qvw:C, 2qvw:D |
7 | 6qv4:A | 1666 | 46 | 0.1210 | 0.0090 | 0.3261 | 4.3 | 6qv3:A |
8 | 8wwu:B | 492 | 64 | 0.1774 | 0.0447 | 0.3438 | 5.9 | 8wwu:A, 8wwu:C, 8wwu:D, 8wwu:E, 8wwu:F, 8wwv:A, 8wwv:B, 8wwv:C, 8wwv:D, 8wwv:E, 8wwv:F, 8x6z:A, 8x6z:B, 8x6z:C, 8x6z:D, 8x6z:E, 8x6z:F |
9 | 8i9i:A | 468 | 46 | 0.1452 | 0.0385 | 0.3913 | 6.8 | 8i9i:B |
10 | 8bja:B | 1638 | 13 | 0.0645 | 0.0049 | 0.6154 | 7.4 | |
11 | 2ww2:B | 737 | 37 | 0.1129 | 0.0190 | 0.3784 | 9.4 |