BioLiP

>protein
GLAVFLPPYPFRGLKAPYLWMFYKYLHCATDSILFITGEDYLSVTDDEAQRARWEFDPASMASLGYELPNAQSMACHEYL
TLDNAFYETLLSRHHHDPIKSFSAFLTERIPDLETELHALLDSKKGIIDQIDTFISICNCPSLEHVARTLGKEVMHIEIG
PLRAPMYRNTAYLDFAGVNGGTEASARYEKCQAEFDIKASLGDLHNYFLEVLPPAETHSAAGVVLQVEDNSNLIAYNHDF
TNISLLSYVRQRYEKEDILVRAHPGSLFRLRDDVFTIDDSANSLAFINQCNEVFTINSSVGLEAILTGKKTTVLGDCSYA
FINELAGASATVNAAAFYLFSYLVPFDLVFNQEYLKFRLGHPEEREIVGKHIEFYSADHSLSSLINEAISLEHH

The query sequence (length=394) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8csd:A	397	396	0.9975	0.9899	0.9924	0.0	8csb:A, 8csb:B, 8csc:A, 8csc:B, 8csd:B, 8cse:B, 8cse:A, 8csf:A, 8csf:B, 5fa1:A, 5fa1:B
2	8fux:A	322	219	0.1193	0.1460	0.2146	0.042	8fuw:A, 8fux:B, 6mgc:A
3	6mgb:A	321	74	0.0482	0.0592	0.2568	0.16
4	4hw8:A	376	42	0.0406	0.0426	0.3810	0.57	4hw8:B
5	7pgr:N	2423	63	0.0584	0.0095	0.3651	0.94	2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N
6	7r04:A	2326	63	0.0584	0.0099	0.3651	0.96
7	6fm7:A	356	104	0.0812	0.0899	0.3077	3.3
8	5bqy:A	324	69	0.0635	0.0772	0.3623	4.0	5bqy:E, 5bqz:A, 5bqz:E
9	4yf9:C	575	62	0.0406	0.0278	0.2581	5.1	4yf9:F, 4yf9:I, 4yf9:L, 4yfa:C, 4yfa:F, 4yfa:I, 4yfa:L, 4yfb:C, 4yfb:F, 4yfb:I, 4yfb:L
10	6eqo:A	1804	74	0.0431	0.0094	0.2297	8.0	6eqo:B

[Back]