BioLiP

>protein
GLAVFLPPYPFRGLKAPYLWMFYKYLHCATDSILFITGEDYLSVTDDEAQRARWEFDPASMASLGYELPNAQSMACHEYL
TLDNAFYETLLSRHHHDPIKSFSAFLTERIPDLETELHALLDSKKGIIDQIDTFISICNCPSLEHVARTLGKEVMHIEIG
PLRAPMYRNTAYLDFAGVNGGTEASARYEKCQAEFDIKASLGDLHNYFLEVLPPAETHSAAGVVLQVEDCSNLIAYNHDF
TNISLLSYVRQRYEKEDILVRAHPGSLFRLRDDVFTIDDSANSLAFINQCNEVFTINSSVGLEAILTGKKTTVLGDCSYA
FINELAGASATVNAAAFYLFSYLVPFDLVFNQEYLKFRLGHPEEREIVGKHIEFYSADMPHSLSSLINEAISLEHHH

The query sequence (length=397) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8csd:A	397	397	1.0000	1.0000	1.0000	0.0	8csb:A, 8csb:B, 8csc:A, 8csc:B, 8csd:B, 8cse:B, 8cse:A, 8csf:A, 8csf:B, 5fa1:A, 5fa1:B
2	8fux:A	322	220	0.1259	0.1553	0.2273	0.051	8fuw:A, 8fux:B, 6mgc:A
3	6mgb:A	321	74	0.0479	0.0592	0.2568	0.19
4	4hw8:A	376	42	0.0403	0.0426	0.3810	0.59	4hw8:B
5	7r04:A	2326	63	0.0579	0.0099	0.3651	0.93
6	7pgr:N	2423	63	0.0579	0.0095	0.3651	0.97	2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N
7	6fm7:A	356	104	0.0806	0.0899	0.3077	3.2
8	4yf9:C	575	62	0.0403	0.0278	0.2581	5.0	4yf9:F, 4yf9:I, 4yf9:L, 4yfa:C, 4yfa:F, 4yfa:I, 4yfa:L, 4yfb:C, 4yfb:F, 4yfb:I, 4yfb:L
9	5z99:A	485	69	0.0453	0.0371	0.2609	9.9	5yyb:A, 5yyb:B

[Back]