BioLiP

>protein
GLAVFLPPYPFRGLKAPYLWMFYKYLHCATDSILFITGEDYLSVTDDEAQRARWEFDPASMASLGYELPNAQSMACHEYL
TLDNAFYETLLSRHHHDPIKSFSAFLTERIPDLETELHALLDSKKGIIDQIDTFISICNCPSLEHVARTLGKEVMHIEIG
PLRAPMYRNTAYLDFAGVNGGTEASARYEKCQAEFDIKASLGDLHNYFLEVLPPAEAHSAAGVVLQVEDDSNLIAYNHDF
TNISLLSYVRQRYEKEDILVRAHPGSLFRLRDDVFTIDDSANSLAFINQCNEVFTINSSVGLEAILTGKKTTVLGDCSYA
FINELAGASATVNAAAFYLFSYLVPFDLVFNQEYLKFRLGHPEEREIVGKHIEFYSADMSSLSSLINEAISLEHH

The query sequence (length=395) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8csd:A	397	396	0.9924	0.9874	0.9899	0.0	8csb:A, 8csb:B, 8csc:A, 8csc:B, 8csd:B, 8cse:B, 8cse:A, 8csf:A, 8csf:B, 5fa1:A, 5fa1:B
2	8fux:A	322	219	0.1215	0.1491	0.2192	0.018	8fuw:A, 8fux:B, 6mgc:A
3	6mgb:A	321	74	0.0481	0.0592	0.2568	0.16
4	4hw8:A	376	42	0.0405	0.0426	0.3810	0.58	4hw8:B
5	7r04:A	2326	63	0.0582	0.0099	0.3651	0.83
6	7pgr:N	2423	63	0.0582	0.0095	0.3651	0.87	2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N
7	6fm7:A	356	152	0.1063	0.1180	0.2763	2.3
8	3t5p:L	302	57	0.0380	0.0497	0.2632	4.4	3t5p:A, 3t5p:B, 3t5p:C, 3t5p:D, 3t5p:E, 3t5p:G, 3t5p:I, 3t5p:J, 3t5p:K, 4wrr:A, 4wrr:B, 4wrr:C, 4wrr:D
9	4yf9:C	575	62	0.0405	0.0278	0.2581	4.9	4yf9:F, 4yf9:I, 4yf9:L, 4yfa:C, 4yfa:F, 4yfa:I, 4yfa:L, 4yfb:C, 4yfb:F, 4yfb:I, 4yfb:L
10	8qv2:Sn	64	40	0.0380	0.2344	0.3750	7.3
11	3t5p:F	273	58	0.0354	0.0513	0.2414	9.6	3t5p:H

[Back]