BioLiP

>protein
GLAVFLPPYPFRGLKAPYLWMFYKYLHCATDSILFITGEDYLSVTDDEAQRARWEFDPASMASLGYELPNAQSMACHEYL
TLDNAFYETLLSRHHHDPIKSFSAFLTERIPDLETELHALLDSKKGIIDQIDTFISICNCPSLEHVARTLGKEVMHIEIG
PLRAPMYRNTAYLDFAGVNGGTEASARYEKCQAEFDIKASLGDLHNYFLEVLPPAEAATHSAAGVVLQVEDCSNLIAYNH
DFTNISLLSYVRQRYEKEDILVRAHPGSLFRLRDDVFTIDDSANSLAFINQCNEVFTINSSVGLEAILTGKKTTVLGDCS
YAFINELAGASATVNAAAFYLFSYLVPFDLVFNQEYLKFRLGHPEEREIVGKHIEFYSAHSLSSLINEAISLE

The query sequence (length=393) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8csd:A	397	396	0.9949	0.9849	0.9874	0.0	8csb:A, 8csb:B, 8csc:A, 8csc:B, 8csd:B, 8cse:B, 8cse:A, 8csf:A, 8csf:B, 5fa1:A, 5fa1:B
2	8fux:A	322	221	0.1272	0.1553	0.2262	0.033	8fuw:A, 8fux:B, 6mgc:A
3	6mgb:A	321	74	0.0483	0.0592	0.2568	0.16
4	4hw8:A	376	42	0.0407	0.0426	0.3810	0.57	4hw8:B
5	7r04:A	2326	63	0.0585	0.0099	0.3651	0.74
6	7pgr:N	2423	63	0.0585	0.0095	0.3651	0.75	2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N
7	5v0t:E	457	72	0.0560	0.0481	0.3056	1.1	5v0t:A, 5v0t:B, 5v0t:C, 5v0t:D, 5v0t:F, 5v0t:G, 5v0t:H
8	6fm7:A	356	104	0.0814	0.0899	0.3077	3.5
9	3t5p:L	302	35	0.0331	0.0430	0.3714	3.8	3t5p:A, 3t5p:B, 3t5p:C, 3t5p:D, 3t5p:E, 3t5p:G, 3t5p:I, 3t5p:J, 3t5p:K, 4wrr:A, 4wrr:B, 4wrr:C, 4wrr:D
10	4yf9:C	575	62	0.0407	0.0278	0.2581	4.6	4yf9:F, 4yf9:I, 4yf9:L, 4yfa:C, 4yfa:F, 4yfa:I, 4yfa:L, 4yfb:C, 4yfb:F, 4yfb:I, 4yfb:L

[Back]