BioLiP

>protein
GKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVL
KAHSA

The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2kzu:A	94	85	1.0000	0.9043	1.0000	2.85e-59	5grq:B, 5grq:A, 5y18:A
2	5mun:A	182	26	0.1294	0.0604	0.4231	1.0
3	5k3i:A	661	65	0.2235	0.0287	0.2923	2.1	5k3i:B, 5k3i:C, 5k3i:D, 5k3i:E, 5k3i:F, 5k3i:G, 5k3i:H
4	6qfb:C	1011	22	0.1176	0.0099	0.4545	5.2
5	8g1e:A	1037	22	0.1176	0.0096	0.4545	5.2	8g1e:B, 8g1e:D, 8g1e:C, 8g1f:A, 8g1f:C, 8g1f:B, 8g1f:D, 8g5c:A, 8g5c:B, 8g5c:C, 8g5c:D, 8g5d:A, 8g5d:B, 8g5d:C, 8g5d:D, 6hxh:A, 6hxh:B, 6hxh:C, 6hxh:D, 6hxh:E, 6hxh:F, 6hxh:G, 6hxh:H, 6hxk:A, 6hxk:B, 6hxk:C, 6hxk:D, 6hxl:A, 6hxl:B, 6hxl:C, 6hxl:D, 6hxl:E, 6hxl:F, 6hxl:G, 6hxl:H, 6hxm:A, 6hxm:B, 7liw:B, 7liw:D, 7lj9:A, 7lj9:B, 7lj9:C, 7lj9:D, 7lla:A, 7lla:C, 7lla:B, 7lla:D, 3mwe:A, 6o0h:A, 6o0h:B, 6o0h:C, 6o0h:D, 3pff:A, 6poe:B, 6poe:D, 6poe:A, 6poe:C, 6qfb:A, 6qfb:B, 6qfb:D, 7rig:A, 7rig:C, 7rig:B, 7rig:D, 7rkz:A, 7rkz:C, 7rkz:B, 7rkz:D, 7rmp:A, 7rmp:C, 7rmp:B, 7rmp:D, 5tde:A, 5tde:B, 5tdf:A, 5tdm:A, 5tdm:B, 5tdz:A, 5te1:A, 5te1:B, 5teq:A, 5teq:B, 5tes:A, 5tet:A, 6ui9:A, 6ui9:C, 6ui9:B, 6ui9:D, 6uia:C, 6uia:A, 6uia:D, 6uia:B, 6uuw:A, 6uuw:C, 6uuw:B, 6uuw:D, 6uuz:A, 6uuz:C, 6uuz:B, 6uuz:D, 6uv5:A, 6uv5:C, 6uv5:B, 6uv5:D, 6z2h:A, 6z2h:C, 6z2h:D
6	7yi8:B	223	29	0.1412	0.0538	0.4138	8.3	7f4p:A, 7f4q:A, 7f4t:A, 7f4t:E, 7f4t:H, 7f4t:K, 7yi9:B
7	7f4m:D	216	29	0.1412	0.0556	0.4138	8.9	7f4l:C, 7f4m:C, 7f4n:C, 7f4n:D

[Back]