GIWAVVPLKAPECAKTRLAGVLSHAARQALFFSMASHVIGTLRASPRIASLLVVTPSESTAEMARAAGAEILWGPPDEGM
ANACSRAMAHIAAAGGERVMFVPGDLPLLDEAAIDMLSRAPVDAIGMAPNRDGHGTNGLICRPGAIPLFFSGPSFSAHQN
AARRAGIDVWVVRSREWALDVDLPADLEEFESSVRDAKRRVLC
The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7p97:AAA | 203 | 203 | 1.0000 | 1.0000 | 1.0000 | 2.35e-146 | 7p97:BBB |
2 | 6bwh:A | 207 | 198 | 0.3103 | 0.3043 | 0.3182 | 7.12e-06 | 6bwh:B, 6bwh:C |
3 | 4gsk:B | 572 | 69 | 0.0985 | 0.0350 | 0.2899 | 0.87 | 4gsk:A |
4 | 8r3g:A | 335 | 57 | 0.1034 | 0.0627 | 0.3684 | 1.0 | 3bxf:A, 3bxg:A, 3bxg:B, 3bxh:A, 3bxh:B, 2okg:B, 7oyk:BBB, 7oyk:AAA, 7oyk:CCC, 7oyk:DDD, 8r3g:B, 8r3g:D, 8r3g:C |
5 | 5hmn:B | 159 | 44 | 0.0788 | 0.1006 | 0.3636 | 1.1 | 5hmn:A, 5hmn:C, 5hmn:E, 5hmn:F |
6 | 3m2t:A | 342 | 56 | 0.0887 | 0.0526 | 0.3214 | 1.8 | 3m2t:B |
7 | 2igi:A | 180 | 53 | 0.0640 | 0.0722 | 0.2453 | 2.0 | 2igi:B, 7vh4:C |
8 | 5d4n:B | 90 | 52 | 0.0887 | 0.2000 | 0.3462 | 3.2 | 5drk:C |
9 | 5gke:A | 239 | 56 | 0.0837 | 0.0711 | 0.3036 | 5.2 | 5gke:B, 5gkf:A, 5gkf:B, 5gkg:A, 5gkg:B, 5gkh:A, 5gkh:B, 5gki:A, 5gki:B |
10 | 1ay0:A | 678 | 73 | 0.1133 | 0.0339 | 0.3151 | 8.5 | 1ay0:B, 1gpu:A, 1gpu:B, 1ngs:A, 1ngs:B, 1tka:A, 1tka:B, 1tkb:A, 1tkb:B, 1tkc:A, 1tkc:B, 1trk:A, 1trk:B |