GIRMSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKT
LTVGDALKQGKIELSGDADLAAKLAEVI
The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3bdq:B | 110 | 108 | 1.0000 | 0.9818 | 1.0000 | 1.56e-72 | 3bdq:A, 2qzt:A, 2qzt:B |
2 | 8af2:A | 123 | 110 | 0.2593 | 0.2276 | 0.2545 | 0.004 | 8af2:B, 8af3:A, 1ikt:A, 6z1w:A, 6z1x:A |
3 | 2yhe:A | 639 | 112 | 0.3148 | 0.0532 | 0.3036 | 0.61 | 4av7:A, 4av7:B, 4av7:C, 4av7:D, 4av7:E, 4av7:F, 4axh:A, 4axh:B, 2yhe:B, 2yhe:C, 2yhe:D, 2yhe:E, 2yhe:F |
4 | 4v4p:AD | 173 | 34 | 0.1019 | 0.0636 | 0.3235 | 1.8 | 4v4r:BD, 4v4s:BD, 4v4t:BD |
5 | 1n83:A | 251 | 29 | 0.1111 | 0.0478 | 0.4138 | 2.5 | 1s0x:A, 4s15:A, 4s15:B |
6 | 2z00:A | 426 | 39 | 0.1204 | 0.0305 | 0.3333 | 4.5 | |
7 | 5myj:BD | 272 | 54 | 0.1944 | 0.0772 | 0.3889 | 5.2 | |
8 | 4v4n:AB | 239 | 34 | 0.1019 | 0.0460 | 0.3235 | 6.0 | 4v6u:BB |
9 | 8rke:B | 279 | 84 | 0.2037 | 0.0789 | 0.2619 | 7.8 | |
10 | 2uvf:A | 571 | 43 | 0.1574 | 0.0298 | 0.3953 | 8.0 | |
11 | 7npk:A | 352 | 87 | 0.2315 | 0.0710 | 0.2874 | 8.3 |