BioLiP

>protein
GIIEFHVIGNSNRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAV
TSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPY

The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5h86:A	167	165	1.0000	0.9581	0.9697	1.39e-117	8e6o:A, 8e6o:B, 8e6o:C, 8h65:C, 8h65:D, 8h65:E, 8h65:F, 8h65:B, 8h65:A, 8h65:G, 8h65:H, 8h66:E, 8h66:C, 8h66:D, 8h66:F, 8h66:B, 8h66:A, 8h66:G, 8h66:H, 8h6c:C, 8h6c:D, 8h6c:E, 8h6c:F, 8h6c:B, 8h6c:A, 8h6c:G, 8h6c:H, 8h6d:C, 8h6d:D, 8h6d:E, 8h6d:F, 8h6d:B, 8h6d:A, 8h6d:G, 8h6d:H, 5h84:A, 5trl:C, 5trl:D, 5trl:E, 5trl:F, 5trl:B, 5trl:A, 5trl:G, 5trl:H, 1z4r:A
2	1cm0:A	162	161	0.8750	0.8642	0.8696	9.30e-106	1cm0:B, 4nsq:A, 4nsq:B, 4nsq:C, 4nsq:D
3	5gcn:A	166	162	0.5375	0.5181	0.5309	1.43e-61	1m1d:A, 1m1d:C, 1pu9:A, 1pua:A, 1q2c:A, 1q2d:A, 1qsn:A, 1qsr:A
4	3b8g:A	424	94	0.1625	0.0613	0.2766	0.18	3d2m:A, 3d2p:A, 3d2p:B, 4i49:A, 2r8v:A, 2r98:A
5	3ld2:B	162	123	0.2000	0.1975	0.2602	0.34	3ld2:A, 3ld2:C, 3ld2:D
6	1o0s:A	602	71	0.1187	0.0316	0.2676	2.0	1llq:A, 1llq:B, 1o0s:B
7	3zyv:B	1262	156	0.2250	0.0285	0.2308	3.9	3zyv:A, 3zyv:C, 3zyv:D
8	7daj:B	150	45	0.0750	0.0800	0.2667	4.5	7daj:A, 7dak:A, 7dak:B, 7dal:A, 7dal:B
9	1tiq:A	173	45	0.1062	0.0983	0.3778	4.8	1tiq:B
10	4axs:A	291	21	0.0625	0.0344	0.4762	5.9
11	2bsw:A	145	43	0.0938	0.1034	0.3488	9.3	2jdc:A, 2jdd:A
12	1b06:A	208	59	0.1000	0.0769	0.2712	9.5	1b06:B, 1b06:C, 1b06:D, 1b06:E, 1b06:F

[Back]