GIFESLYKVVMRRNSVYVTFVIAGAFLGERAVDYGIHKLWEANNVGKRYEDIPVLGQKL
The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8e73:V | 59 | 59 | 1.0000 | 1.0000 | 1.0000 | 8.06e-39 | 8e73:J |
2 | 8bel:I | 57 | 56 | 0.7797 | 0.8070 | 0.8214 | 3.93e-31 | 8bel:S, 8bpx:AI, 8bpx:BI, 8bq5:AI, 8bq5:BI, 8bq6:AI, 8bq6:BI |
3 | 1be3:J | 62 | 47 | 0.2881 | 0.2742 | 0.3617 | 5.22e-05 | 1bgy:J, 1bgy:V, 7dkf:J1, 7dkf:V1, 5luf:j, 5luf:v, 5nmi:W, 5nmi:J, 1sqp:J, 2ybb:j, 2ybb:J |
4 | 5xte:D | 62 | 48 | 0.2712 | 0.2581 | 0.3333 | 6.19e-04 | 5xte:Q, 5xth:AD, 5xth:AQ, 5xti:AD, 5xti:AQ |
5 | 1iyb:A | 208 | 19 | 0.1864 | 0.0529 | 0.5789 | 0.21 | 1iyb:B |
6 | 1h2b:B | 344 | 44 | 0.2881 | 0.0494 | 0.3864 | 0.81 | 1h2b:A |
7 | 4twe:A | 706 | 34 | 0.2373 | 0.0198 | 0.4118 | 2.9 | 4twe:B |
8 | 2cy2:A | 174 | 20 | 0.1695 | 0.0575 | 0.5000 | 3.7 | |
9 | 8auv:G | 83 | 34 | 0.1356 | 0.0964 | 0.2353 | 6.7 | 8b2l:G1 |
10 | 5edf:A | 224 | 49 | 0.2203 | 0.0580 | 0.2653 | 6.7 | |
11 | 3if2:A | 437 | 46 | 0.2542 | 0.0343 | 0.3261 | 8.5 | 3if2:B |
12 | 3waj:A | 793 | 38 | 0.2203 | 0.0164 | 0.3421 | 8.6 | |
13 | 7e9s:A | 867 | 38 | 0.2203 | 0.0150 | 0.3421 | 8.6 | 5gmy:A, 3wak:A |