GIDPFTMSDLPCPPTNAERLHEFHRAIGAATPERPTPPPPELLRLRQTLLDEESAEVRAEIDHLLARQAAGEALSAGDLA
PLAHELADLLYVTYGALDQLGIDADAVFAEVHRANLSKASGPRRADGKQLKPEGWRPADVRGVIERLQHA
The query sequence (length=150) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2yf3:C | 153 | 149 | 0.9933 | 0.9739 | 1.0000 | 4.90e-105 | 5hva:A, 5hva:B, 5hva:C, 5hva:D, 5hwu:A, 5hwu:B, 5hx1:A, 5hx1:C, 5hx1:B, 5hx1:D, 5hyl:A, 5hyl:C, 5hyl:B, 5hyl:D, 5hzz:A, 5hzz:B, 5hzz:C, 5hzz:D, 5i0j:A, 5i0j:D, 5i0j:B, 5i0j:C, 5i0m:A, 5i0m:D, 5i0m:B, 5i0m:C, 2yf3:A, 2yf3:B, 2yf3:D, 2yf3:E, 2yf3:F, 2yfc:A, 2yfc:B, 2yfc:C, 2yfc:D, 2yfd:A, 2yfd:B, 2yfd:C, 2yfd:D |
| 2 | 4rul:A | 823 | 91 | 0.1800 | 0.0328 | 0.2967 | 1.7 | 1cy1:A, 1cy2:A, 1cy4:A, 1cy6:A, 1cy7:A, 1cy8:A, 1mw8:X, 3px7:A |
| 3 | 3tqo:A | 387 | 50 | 0.1267 | 0.0491 | 0.3800 | 2.9 | |
| 4 | 5zeb:1 | 60 | 57 | 0.0933 | 0.2333 | 0.2456 | 3.1 | 6dzi:a, 6dzp:a, 8fr8:7, 8kab:a, 5o60:a, 5o61:a, 7s0s:b, 8v9j:2, 8v9k:2, 8v9l:2, 8whx:3, 8why:3, 8wi7:3, 8wi8:3, 8wib:3, 8wic:3, 7xam:a, 5xym:Z, 8xz3:a, 7y41:a, 5zep:v, 5zet:1 |
| 5 | 2yxh:A | 114 | 48 | 0.1000 | 0.1316 | 0.3125 | 8.4 | 2yxh:B |
| 6 | 2ge3:A | 164 | 40 | 0.0933 | 0.0854 | 0.3500 | 8.8 | 2ge3:B, 2ge3:C |
| 7 | 8jnc:A | 391 | 83 | 0.1533 | 0.0588 | 0.2771 | 9.5 | 8jnc:B, 8jno:A, 8jno:B, 8joo:A, 8joo:B, 8jua:A, 8jua:B |
| 8 | 4df2:A | 404 | 75 | 0.1600 | 0.0594 | 0.3200 | 9.8 | 4m5p:A, 4qai:A, 4qai:B, 4qai:C, 4qai:D, 4qai:E, 4qai:F, 3tjl:A, 3upw:A |
umich.edu