BioLiP

>protein
GIDPFTKTSLYESTLKNQTDLLKVTQSTVEDFRSTNQSFTRALEKDIANLPYQSLITEENIINNVGPILKYYRHSINALN
VYLGLNNGKVLLSQKSKMPELRDDLDIKTKDWYQEALKTNDIFVTPAYLDTVLKQYVITYSKAIYKDGKIIGVLGVDIPS
EDLQNLVAKTPGNTFLFDQKNKIFAATNKELLNPSIDHSPVLNAYKLNGDNNFFSYKLNNEERLGACTKVFAYTACITES
ADIINKPIYKA

The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6w3o:B	252	252	1.0000	0.9960	0.9960	0.0	6w3o:A, 6w3p:A, 6w3p:B, 6w3r:A, 6w3r:B, 6w3s:A, 6w3s:B, 6w3t:A, 6w3t:B, 6w3v:A, 6w3v:B, 6w3x:A, 6w3x:B, 6w3y:A, 6w3y:B, 4xmr:A, 4xmr:B
2	6py3:B	238	119	0.1434	0.1513	0.3025	1.27e-09	6pxy:A, 6py3:A, 6py4:A, 6py5:A, 6pyi:A, 6q0f:A, 6q0g:A
3	5ltx:A	243	153	0.1434	0.1481	0.2353	3.03e-07	5ltx:B, 5t65:A, 5t65:B, 5t7m:A, 5t7m:B
4	5lt9:B	253	159	0.1474	0.1462	0.2327	3.21e-04	5lt9:A, 5lto:A, 5lto:B
5	6d8v:A	269	97	0.1235	0.1152	0.3196	0.003
6	6f9g:D	262	67	0.0996	0.0954	0.3731	0.004	6f9g:A, 6f9g:B, 6f9g:C, 6f9g:E
7	6fu4:A	297	74	0.0956	0.0808	0.3243	0.016	6fu4:B, 6fu4:C, 6fu4:D
8	2o2c:A	564	119	0.1195	0.0532	0.2521	0.20	2o2c:B, 2o2c:C
9	6ior:A	241	64	0.0677	0.0705	0.2656	0.87	6iop:A, 6iop:B, 6ioq:A, 6ior:B, 6ior:C, 6ior:D, 6ios:A, 6iot:A, 6iot:B, 6iot:C, 6iot:D, 6iou:A, 6iou:B
10	8bmv:B	249	83	0.0876	0.0884	0.2651	1.1	8bmv:A
11	1l1q:A	181	61	0.0876	0.1215	0.3607	1.1	1l1r:A
12	5ave:A	252	93	0.0797	0.0794	0.2151	1.5	5avf:A, 5avf:B, 3c8c:A, 3c8c:B, 6iov:A, 6iov:B
13	6rm3:LLL	51	24	0.0359	0.1765	0.3750	2.9
14	3fid:A	296	88	0.1036	0.0878	0.2955	3.5	3fid:B
15	3ksg:A	153	19	0.0478	0.0784	0.6316	6.1	3ksg:B
16	7ase:5	421	30	0.0398	0.0238	0.3333	6.8
17	6l7x:A	203	31	0.0518	0.0640	0.4194	8.8	6l7w:A, 6l7y:A

[Back]