BioLiP

>protein
GHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVD
YRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELL
FIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLC
VSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQKLMEPLKYAEQLPVAQIIHQKPKLKDWHPPGGFILGLWAL
IIMVFFKTYG

The query sequence (length=330) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7wld:K	331	330	0.9939	0.9909	0.9939	0.0	8imx:K, 8imy:K, 7w72:K
2	7fqi:A	265	214	0.2091	0.2604	0.3224	2.90e-27	4aw9:A, 4awa:A, 4awb:A, 4awb:B, 7fqh:A, 7fqh:B, 7fqh:D, 7fqi:C, 7fqi:B, 7fqj:A, 7fqj:C, 7fqj:B, 7fqk:A, 7fqk:B, 7fqk:C, 7fqk:D, 7fql:A, 7fql:F, 7fql:B, 7fql:H, 7fql:C, 7fql:G, 7fql:D, 7fql:E, 5lu8:A, 5lu9:A, 5lua:B, 5lub:B, 7o50:A, 7o50:B
3	6azt:A	274	190	0.1758	0.2117	0.3053	4.51e-22
4	5obt:B	230	190	0.1727	0.2478	0.3000	3.65e-21	5obt:A
5	6idv:A	425	246	0.1970	0.1529	0.2642	6.35e-21	6idv:B
6	5bsz:A	247	107	0.0727	0.0972	0.2243	0.34
7	3vc6:A	420	68	0.0667	0.0524	0.3235	0.80
8	3n75:A	711	54	0.0636	0.0295	0.3889	2.1	3n75:D, 3n75:B, 3n75:E, 3n75:C, 6q7l:A, 6q7l:F, 6q7l:B, 6q7l:C, 6q7l:D, 6q7l:J, 6q7l:E, 6q7l:H, 6q7l:G, 6q7l:I, 6q7l:K, 6q7l:R, 6q7l:L, 6q7l:Q, 6q7l:M, 6q7l:P, 6q7l:N, 6q7l:T, 6q7l:O, 6q7l:S, 6q7m:A, 6q7m:F, 6q7m:B, 6q7m:C, 6q7m:D, 6q7m:J, 6q7m:E, 6q7m:H, 6q7m:G, 6q7m:I, 6q7m:K, 6q7m:R, 6q7m:L, 6q7m:Q, 6q7m:M, 6q7m:P, 6q7m:N, 6q7m:O, 6q7m:S, 6q7m:T
9	8fok:1	1046	136	0.1091	0.0344	0.2647	5.6	3flo:B, 3flo:D, 3flo:F, 3flo:H, 4fxd:A, 4fxd:B, 4fyd:A, 4fyd:B
10	2j5s:A	250	162	0.1091	0.1440	0.2222	9.0	2j5s:B

[Back]