GHMNTIKTVIISELEKNVDEFLNSYLEYLKYDDYDQYCTMIGLYDELTDQESISQIPTKYSIDPINFQKFTRVLTVAIYN
YDVNYILAEKYKELFEFTNMDPDFSPKYRFYSPIATCSYLSQYDLISESFQQDVTKLFDRMHKQQPGCMLMNQIMVSNLI
KNLLKNV
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8c6v:D | 167 | 167 | 1.0000 | 1.0000 | 1.0000 | 1.12e-122 | |
2 | 6grd:A | 407 | 75 | 0.1138 | 0.0467 | 0.2533 | 0.54 | 5cnq:A, 5co8:C, 5co8:A, 6grb:A, 6grc:A |
3 | 7cmy:C | 417 | 71 | 0.1198 | 0.0480 | 0.2817 | 1.4 | |
4 | 3lqd:A | 141 | 100 | 0.1497 | 0.1773 | 0.2500 | 4.7 | 3lqd:C, 2rao:A, 2rao:C |
5 | 3son:A | 147 | 71 | 0.1138 | 0.1293 | 0.2676 | 5.1 | 3son:B |
6 | 3vre:A | 141 | 52 | 0.0838 | 0.0993 | 0.2692 | 6.0 | 3vre:C, 3vrf:A, 3vrg:A |