GHMGAQWNCTACTFLNHPALIRCEQCEMPRHF
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3a9j:C | 32 | 32 | 1.0000 | 1.0000 | 1.0000 | 1.18e-19 | 9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C |
2 | 1nj3:A | 31 | 30 | 0.4375 | 0.4516 | 0.4667 | 4.27e-05 | 1q5w:A |
3 | 7mnr:B | 40 | 27 | 0.3125 | 0.2500 | 0.3704 | 0.006 | |
4 | 7mo2:B | 38 | 24 | 0.2812 | 0.2368 | 0.3750 | 0.009 | 3ch5:B, 7mo2:D |
5 | 2ebq:A | 47 | 24 | 0.3125 | 0.2128 | 0.4167 | 0.010 | 2gqe:A, 2k0c:A |
6 | 2crc:A | 52 | 20 | 0.3125 | 0.1923 | 0.5000 | 0.027 | |
7 | 8im5:A | 66 | 20 | 0.3125 | 0.1515 | 0.5000 | 0.029 | 3b0a:E |
8 | 8pp6:K | 36 | 24 | 0.2500 | 0.2222 | 0.3333 | 0.091 | |
9 | 7mns:B | 38 | 25 | 0.2812 | 0.2368 | 0.3600 | 0.15 | |
10 | 2d9g:A | 53 | 22 | 0.2500 | 0.1509 | 0.3636 | 0.16 | |
11 | 7yui:B | 232 | 20 | 0.3125 | 0.0431 | 0.5000 | 0.20 | 3b08:K, 3b08:B, 3b08:E, 3b08:H, 3b0a:B |
12 | 7mnt:B | 38 | 25 | 0.2500 | 0.2105 | 0.3200 | 0.26 | 7mnt:D, 7mnu:B |
13 | 7mnv:B | 38 | 26 | 0.2188 | 0.1842 | 0.2692 | 0.29 | |
14 | 7mnp:B | 39 | 21 | 0.2500 | 0.2051 | 0.3810 | 0.52 | 7mnp:D, 7mnq:B |
15 | 1gax:A | 862 | 37 | 0.4062 | 0.0151 | 0.3514 | 0.52 | 1gax:B, 1ivs:A, 1ivs:B, 1wk9:A |
16 | 2k1p:A | 33 | 31 | 0.2500 | 0.2424 | 0.2581 | 1.2 | |
17 | 2c6a:A | 46 | 24 | 0.2500 | 0.1739 | 0.3333 | 3.2 | 2c6b:A, 4xxb:B |
18 | 9b4h:A | 1908 | 19 | 0.2500 | 0.0042 | 0.4211 | 4.2 | 9b4h:B, 8wa2:A, 8wa2:D, 8wa2:F, 8wa2:B, 8wa2:C, 8wa2:E |
19 | 6z2w:E | 2325 | 18 | 0.3125 | 0.0043 | 0.5556 | 5.2 | 6z2w:F, 6z2x:E, 6z2x:F, 6z3a:F, 6z3a:E |
20 | 2cr8:A | 53 | 21 | 0.2500 | 0.1509 | 0.3810 | 6.5 | |
21 | 7z0s:E | 532 | 15 | 0.2188 | 0.0132 | 0.4667 | 7.3 | 7z0t:E |
22 | 2b7r:A | 568 | 25 | 0.1875 | 0.0106 | 0.2400 | 7.7 | 2b7s:A, 1e39:A, 1jrx:A, 1jrx:B, 1jry:A, 1jry:B, 1jrz:A, 1jrz:B, 1kss:A, 1ksu:A, 1ksu:B, 1lj1:A, 1lj1:B, 1m64:A, 1m64:B, 1p2e:A, 1p2h:A, 1q9i:A, 1qjd:A, 1y0p:A |
23 | 7r7j:B | 574 | 20 | 0.2500 | 0.0139 | 0.4000 | 8.0 | 8h5y:B, 8h5y:A, 8h5z:B, 8h5z:A, 6jde:B, 6jde:A, 7r7j:A |
24 | 2fiy:A | 285 | 25 | 0.2500 | 0.0281 | 0.3200 | 8.8 | 2fiy:B |