Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
GHMAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFI
LDNVQVVLQQTYGSTLKVT

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6c8c:A 119 96 0.9394 0.7815 0.9688 4.31e-65 6c8c:B, 4fjo:A, 4gk5:E, 2lsi:A, 2lsj:A, 2lsk:A, 2n1g:A
2 7kii:A 103 23 0.0909 0.0874 0.3913 0.18 7kij:C, 7kij:A
3 5abs:A 66 54 0.1616 0.2424 0.2963 0.77
4 6fb3:A 1836 44 0.1414 0.0076 0.3182 1.6 6fb3:B, 6fb3:C, 6fb3:D, 6ska:A, 6ske:A, 6ske:C
5 7plm:A 1177 31 0.1212 0.0102 0.3871 1.7 7plm:B
6 4e6n:A 407 63 0.1818 0.0442 0.2857 2.3 4e6n:C, 3ty5:A, 3ty5:B, 3ty9:A, 3ty9:B, 3ty9:C, 3ty9:D
7 1cjy:A 633 30 0.1313 0.0205 0.4333 5.8 1bci:A, 1cjy:B, 1rlw:A
8 1cjy:A 633 69 0.1414 0.0221 0.2029 8.5 1bci:A, 1cjy:B, 1rlw:A
9 7zol:B 1702 57 0.1818 0.0106 0.3158 7.9 7zoq:B
10 6zaz:A 555 48 0.1717 0.0306 0.3542 8.8 8aa0:B, 8aa0:J, 8aa1:B, 8aa1:J, 8aa2:B, 8aa2:J, 8aa3:B, 8aa3:J, 5t3r:A, 5t4y:A, 5t4y:B, 6z8i:A, 6z9a:A
11 1coz:A 126 68 0.2222 0.1746 0.3235 9.0 1coz:B, 1n1d:A, 1n1d:B, 1n1d:C, 1n1d:D

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218