BioLiP

>protein
GHIIRATRKDRHSKVFTSKGPRDRRVRMSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKTAIDK

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7vp2:A	83	66	0.9846	0.7711	0.9697	1.21e-40	7vp1:A, 7vp1:B, 7vp2:B, 7vp4:B, 7vp4:A, 7vp4:F, 7vp4:E, 7vp4:J, 7vp4:I, 7vp5:A, 7vp5:B, 7vp5:E, 7vp5:F, 7vp5:I, 7vp5:J, 7vp7:A, 7vp7:B
2	7vp3:C	62	55	0.3077	0.3226	0.3636	8.59e-07	7vp3:D, 7vp3:J, 7vp3:G, 7vp3:L, 7vp3:I, 7vp3:N, 7vp3:P
3	6xpn:B	259	33	0.1538	0.0386	0.3030	1.4	6xpn:A
4	2yck:X	272	66	0.2615	0.0625	0.2576	2.0	2yci:X, 2ycj:A
5	8gy9:A	249	34	0.2154	0.0562	0.4118	2.7	8gy9:B, 8gya:A, 8gya:B, 8gyb:A, 8gyb:B, 8gyb:C, 8gyb:D
6	3no5:E	275	17	0.1385	0.0327	0.5294	4.5	3no5:A, 3no5:B, 3no5:C, 3no5:D, 3no5:F
7	7wrr:A	650	38	0.2000	0.0200	0.3421	6.2	7wrr:B, 7wrr:C, 7wrr:D, 7wrt:A, 7wrt:B, 7wrt:C, 7wrt:D
8	4ylz:C	140	37	0.1692	0.0786	0.2973	6.9	5cbl:A, 5cbl:B, 5cbl:C, 5cbl:D, 6wab:A, 6wab:B, 4ylz:A, 4ylz:B, 4ylz:D, 4ym0:D, 4ym0:A, 4ym0:B, 4ym0:C, 4ym1:A, 4ym1:B, 4ym1:C, 4ym2:A, 4ym2:B, 4ym2:C, 4ym2:D, 4ym3:A, 4ym3:B, 4ym3:C, 4ym3:D
9	9biw:B	528	40	0.1692	0.0208	0.2750	7.9	9biw:A
10	3upt:A	671	42	0.1846	0.0179	0.2857	8.7	3upt:B
11	2wl9:A	300	36	0.2000	0.0433	0.3611	8.8	2wl3:A, 2wl3:B, 2wl3:C, 2wl3:D, 2wl9:B, 2wl9:C, 2wl9:D
12	3puo:A	292	27	0.1538	0.0342	0.3704	9.3	3puo:B, 3s8h:A, 3s8h:B
13	5hkc:A	114	28	0.1538	0.0877	0.3571	9.6	5hk0:B, 5hk0:D, 5hk3:B

[Back]