GHDKIITGKKIIFSQSVAKDQTKNLSSFLSERFYSVNQSHNHSIIIGSSLSHQEIEHDTILDTSGVLVTTDTNGIVNGAR
VAITDGLGGGNGDQEEDDEIYRVSHSSCENFLNCDQNIDTTLSLITQPTEASMAAFIYQNHPGKGYIGEFANIGAGLIII
LDKRFKIKHMVSACHIYRGFGTWTPPSLQALATTANKDALLVRQTLKLAEGDIIISMTDGVWGELKTSLIAQTNDRRDIG
VDKEYFKTLFDELTDAPYPSSFDIARIITQRAMSRSLERRKTLIKLIVMHDLKSRTVGDCSTINVTRIPYHLDELIRGFI
NYPEKHQILAPLFKARVKSEADLEEAFHRLSLEMVQPEIECPISETHFERAFKKETLDKTQAVLTHYFRIS
The query sequence (length=391) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8anp:D | 391 | 391 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 8anp:A | 417 | 417 | 0.9949 | 0.9329 | 0.9329 | 0.0 | |
3 | 8agg:A | 489 | 441 | 0.9693 | 0.7751 | 0.8594 | 0.0 | 8alk:A, 8anp:C |
4 | 8anp:B | 454 | 455 | 0.8261 | 0.7115 | 0.7099 | 0.0 | |
5 | 3ts3:B | 205 | 58 | 0.0563 | 0.1073 | 0.3793 | 3.8 | 3ts3:C, 3ts3:D |
6 | 7clf:A | 335 | 36 | 0.0332 | 0.0388 | 0.3611 | 7.5 | 7clf:B |
7 | 6sj2:B | 503 | 45 | 0.0358 | 0.0278 | 0.3111 | 8.3 | 6sj0:A, 6sj0:B, 6sj1:A, 6sj1:B, 6sj2:A, 6sj3:A, 6sj3:B, 6sj4:A, 6sj4:B |