GGLRRRDLPADPLTLFERWLSQACEAKLADPTAMVVATVDEHGQPYQRIVLLKHYDEKGMVFYTNLGSRKAHQIENNPRV
SLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWG
GFRVSLEQIEFWQGGEHRLHDRFLYQRENDAWKIDRLAP
The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jnw:A | 214 | 199 | 1.0000 | 0.9299 | 1.0000 | 1.10e-149 | 1dnl:A, 1g76:A, 1g77:A, 1g78:A, 1g79:A, 6ylz:AAA, 6ymh:BBB |
2 | 1wv4:A | 162 | 199 | 0.7688 | 0.9444 | 0.7688 | 1.23e-105 | 1wv4:B, 6ymh:AAA |
3 | 1ci0:A | 205 | 203 | 0.4271 | 0.4146 | 0.4187 | 1.01e-48 | 1ci0:B |
4 | 1nrg:A | 213 | 178 | 0.3920 | 0.3662 | 0.4382 | 2.79e-46 | 6h00:A, 3hy8:A, 8qyt:A, 8qyw:A |
5 | 4hmt:B | 207 | 192 | 0.3116 | 0.2995 | 0.3229 | 3.08e-34 | 4hms:A, 4hms:B, 4hmt:A, 4hmu:A, 4hmu:B, 4hmv:A, 4hmv:B, 1ty9:A, 1ty9:B |
6 | 1t9m:A | 204 | 191 | 0.3116 | 0.3039 | 0.3246 | 3.18e-31 | 1t9m:B |
7 | 4hmw:B | 205 | 194 | 0.2965 | 0.2878 | 0.3041 | 2.40e-26 | 4hmw:A, 4hmx:A, 4hmx:B |
8 | 2i02:A | 140 | 66 | 0.0955 | 0.1357 | 0.2879 | 0.55 | 2i02:B |
9 | 4fb3:A | 115 | 65 | 0.0854 | 0.1478 | 0.2615 | 0.55 | 4fb3:B, 4fb3:E |
10 | 3jd5:I | 311 | 137 | 0.1759 | 0.1125 | 0.2555 | 0.61 | 6neq:I, 6nf8:I |
11 | 8jg7:E | 409 | 90 | 0.1206 | 0.0587 | 0.2667 | 1.4 | 8jg7:A, 8jg7:C, 8jg7:D |
12 | 7rzb:A | 138 | 52 | 0.0804 | 0.1159 | 0.3077 | 1.6 | |
13 | 2xgt:B | 433 | 61 | 0.0905 | 0.0416 | 0.2951 | 2.7 | 2xgt:A, 2xti:A, 2xti:B |
14 | 5ck5:A | 221 | 42 | 0.0804 | 0.0724 | 0.3810 | 4.2 | 5ck4:A, 5ck4:B, 5ck5:B, 5ck5:C, 5ck5:D |
15 | 3ec6:A | 129 | 76 | 0.1307 | 0.2016 | 0.3421 | 8.5 | |
16 | 6hiv:CH | 273 | 14 | 0.0553 | 0.0403 | 0.7857 | 9.8 | 6hiw:CH, 6hiy:CH, 7pub:CH |
17 | 6sga:CH | 222 | 14 | 0.0553 | 0.0495 | 0.7857 | 9.8 | 7pua:CH, 6sgb:CH |
18 | 7p2e:G | 330 | 107 | 0.1307 | 0.0788 | 0.2430 | 9.8 | 7a5f:G6, 7a5g:G6, 7a5i:G6, 7a5k:G6, 8any:AG, 8csp:G, 8csq:G, 8csr:G, 8css:G, 8cst:G, 8csu:G, 3j9m:AG, 8k2a:SI, 7l08:AG, 6nu2:AG, 6nu3:AG, 7og4:AG, 8oir:Ag, 8ois:Ag, 7pnx:G, 7pny:G, 7pnz:G, 7po0:G, 7po1:G, 7po2:G, 7po3:G, 7qi4:AG, 7qi5:AG, 7qi6:AG, 8qrk:G, 8qrl:G, 8qrm:G, 8qrn:G, 6rw4:G, 6rw5:G, 6vlz:AG, 6vmi:AG, 8xt0:SI, 8xt2:SI, 6zm5:AG, 6zm6:AG, 6zs9:AG, 6zsa:AG, 6zsb:AG, 6zsc:AG, 6zsd:AG, 6zse:AG, 6zsg:AG |