BioLiP

>protein
GGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAA
KEAKEAPVEVKKFVKIGRPGYKVTKQLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPFW
THWNRETKQFFLQ

The query sequence (length=173) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i0r:v	173	173	1.0000	1.0000	1.0000	5.93e-132	7abg:F, 7abh:F, 6ff4:7, 6ff7:7, 8i0p:v, 8i0t:v, 7q4o:1, 7q4p:1, 8qo9:G, 6qx9:A2, 8qxd:8, 8r0a:8, 8r0b:8, 8rm5:8, 7vpx:B
2	8ch6:I	185	188	0.8439	0.7892	0.7766	7.31e-94	7abi:F, 7onb:M, 7qtt:I, 5z56:v, 5z57:v
3	7dco:v	207	169	0.2717	0.2271	0.2781	3.82e-11	5gm6:I, 5zwm:v, 5zwo:v
4	5nrl:U	196	143	0.2370	0.2092	0.2867	4.89e-10
5	6g90:U	196	148	0.2312	0.2041	0.2703	4.36e-08	7oqb:U, 7oqe:U
6	8qzs:r	114	36	0.0751	0.1140	0.3611	0.010	7abf:N, 7abg:N, 7abi:N, 8h6k:4N, 5o9z:N, 8q7n:r, 8qpe:r
7	1zu1:A	127	46	0.0983	0.1339	0.3696	0.095
8	8idf:A	459	40	0.0867	0.0327	0.3750	0.13
9	1deh:A	374	45	0.0925	0.0428	0.3556	4.5	1deh:B, 1hdx:A, 1hdx:B, 1hdy:A, 1hdy:B, 1hdz:A, 1hdz:B, 1hso:A, 1hso:B, 1hsz:A, 1hsz:B, 1ht0:A, 1ht0:B, 1htb:A, 1htb:B, 3hud:A, 3hud:B, 1u3t:A, 1u3t:B, 1u3u:A, 1u3u:B, 1u3v:A, 1u3v:B, 1u3w:A, 1u3w:B
10	6yxy:AE	434	56	0.1214	0.0484	0.3750	5.3	7aih:A, 7am2:A, 7ane:A, 7aoi:AE, 6yxx:AE
11	6jbc:A	295	50	0.1098	0.0644	0.3800	6.4	6jbd:A
12	1xed:A	111	39	0.0694	0.1081	0.3077	7.3	1xed:B

[Back]