GGGASAPGVYVTPKNSVSSDIISIDWSPVQTAPYTYWAVHNWNQGGEAGGYAGFQQQSGFDENGKRTLHFAVWDPISSKE
AIKAEYVSPTSVASNFGGEGTGLKIQTTYDWKNYNWYRMTMRSWQENGHTKFGQWLKDVSKNQWKLIGIMDFPVPNVTFN
YGQTLFQADWLGNGQDVREARVKNGYGRNISDKKWTSWNTQSIEGQEPLNNNWDGGATSEYLWFKAGGDSRSTIGTGKTF
TLNQPSQPEIGKLDYDVKSTYYENEKLNITWQLKDSSTPQFKGKIEIYNNENMTGQPINVINDIKSYQNGISQSISLPTN
TYAKIVLTDIFDQTVEKKVKIKNE
The query sequence (length=344) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8pn5:E | 344 | 344 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8pn3:A, 8pn3:B, 8pn5:A, 8pn5:B, 8pn5:C, 8pn5:H, 8pn5:F, 8pn5:G, 8pn5:D |
2 | 4au2:C | 338 | 158 | 0.0959 | 0.0976 | 0.2089 | 0.014 | |
3 | 3sae:A | 780 | 33 | 0.0349 | 0.0154 | 0.3636 | 3.6 | 3sdr:A, 3sdt:A, 3sdu:A, 3sdv:A |
4 | 3tc8:A | 293 | 50 | 0.0552 | 0.0648 | 0.3800 | 6.6 | 3tc8:B |
5 | 6ybb:F | 280 | 59 | 0.0494 | 0.0607 | 0.2881 | 9.9 | 6tj0:A, 6tj0:B, 6ybb:E |