BioLiP

>protein
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEH
IPDSPFVVPVASP

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4p3w:A	172	93	1.0000	0.5407	1.0000	3.61e-62	2brq:A, 2brq:B, 3isw:A, 3isw:B, 2jf1:A, 2mtp:A, 4p3w:B, 4p3w:E, 4p3w:F, 4p3w:D, 4p3w:C, 7sft:A, 2w0p:A, 2w0p:B
2	4p3w:A	172	69	0.2366	0.1279	0.3188	0.21	2brq:A, 2brq:B, 3isw:A, 3isw:B, 2jf1:A, 2mtp:A, 4p3w:B, 4p3w:E, 4p3w:F, 4p3w:D, 4p3w:C, 7sft:A, 2w0p:A, 2w0p:B
3	2k9u:A	119	92	0.9032	0.7059	0.9130	5.84e-57
4	2bp3:A	91	88	0.4839	0.4945	0.5114	3.51e-29	2bp3:B
5	4mgx:A	181	84	0.4194	0.2155	0.4643	1.34e-17
6	4mgx:A	181	88	0.3226	0.1657	0.3409	5.08e-06
7	6fq3:A	390	97	0.3441	0.0821	0.3299	8.93e-07	6fql:A
8	5xya:A	1358	55	0.1935	0.0133	0.3273	2.4	5xxz:A
9	7edd:A	1394	55	0.1935	0.0129	0.3273	2.4	5xyr:A
10	5xxz:B	1310	55	0.1935	0.0137	0.3273	2.6
11	2exh:A	533	32	0.1290	0.0225	0.3750	3.5	2exh:B, 2exh:C, 2exh:D, 2exi:A, 2exi:B, 2exi:C, 2exi:D, 2exj:A, 2exj:B, 2exj:C, 2exj:D, 2exk:A, 2exk:B, 2exk:C, 2exk:D
12	7tz2:A	220	55	0.1720	0.0727	0.2909	4.8
13	7zvs:A	300	67	0.2043	0.0633	0.2836	5.4	7zvs:B
14	6sg9:FL	320	31	0.1398	0.0406	0.4194	5.5	6sgb:FL
15	2ror:A	138	38	0.1398	0.0942	0.3421	5.6	2lct:A, 2mc1:A
16	1xsc:A	153	53	0.2151	0.1307	0.3774	7.3	4ick:B, 4ijx:A, 4ijx:B
17	6jta:A	1298	46	0.1720	0.0123	0.3478	8.6	7dw7:A, 6jt7:A, 6jt8:A, 6jt9:A, 4l78:A, 4lgy:A, 6lyk:A, 6lyl:A, 6lym:A, 6lyo:A, 4mgh:A, 4r7g:A, 1t3t:A, 3ugj:A, 3ujn:A, 3umm:A
18	4hly:B	106	32	0.1398	0.1226	0.4062	8.7

[Back]