BioLiP

>protein
GFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRIN

The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8pp6:K	36	36	1.0000	1.0000	1.0000	2.69e-21
2	2d9g:A	53	34	0.8611	0.5849	0.9118	1.40e-18
3	7mnv:B	38	26	0.3611	0.3421	0.5000	6.06e-04
4	7mnt:B	38	23	0.3889	0.3684	0.6087	8.71e-04	7mnt:D, 7mnu:B
5	2ebq:A	47	33	0.3889	0.2979	0.4242	0.001	2gqe:A, 2k0c:A
6	7mo2:B	38	26	0.3333	0.3158	0.4615	0.002	3ch5:B, 7mo2:D
7	7mo5:B	36	26	0.3333	0.3333	0.4615	0.005
8	7mns:B	38	22	0.3333	0.3158	0.5455	0.017
9	7mnp:B	39	23	0.2778	0.2564	0.4348	0.024	7mnp:D, 7mnq:B
10	7mnr:B	40	23	0.2778	0.2500	0.4348	0.049
11	2ebr:A	47	24	0.2778	0.2128	0.4167	0.065
12	2ebv:A	57	26	0.3611	0.2281	0.5000	0.091
13	3a9j:C	32	24	0.2222	0.2500	0.3333	0.10	9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C
14	7mo3:B	38	26	0.3056	0.2895	0.4231	0.63	7mo3:D, 7mo4:B, 7mo4:D
15	1nj3:A	31	25	0.2222	0.2581	0.3200	0.82	1q5w:A
16	7lw7:A	277	26	0.2500	0.0325	0.3462	4.9	7lw8:A, 7lw9:A, 7lwa:A
17	4iqr:F	314	32	0.3056	0.0350	0.3438	5.1	8c1l:B, 3cbb:A, 3cbb:B, 6cht:A, 6cht:D, 6cht:G, 6cht:J, 3fs1:A, 4iqr:A, 4iqr:B, 4iqr:E, 1pzl:A
18	8f5o:B	1134	33	0.3889	0.0123	0.4242	8.4	8f5p:B
19	8im5:A	66	20	0.2222	0.1212	0.4000	9.5	3b0a:E

[Back]