BioLiP

>protein
GFLVAAIQFPVPIVNSRKDIDHNIESIIRTLHATKAGYPGVELIIFPEYSTQGLNTAKWLSEEFLLDVPGKETELYAKAC
KEAKVYGVFSIMERNPDSNKNPYNTAIIIDPQGEIILKYRKLFPWNPIEPWYPGDLGMPVCEGPGGSKLAVCISHDGMIP
ELAREAAYKGCNVYIRISGYSTQVNDQWILTNRSNAWHNLMYTVSVNLAGYYFGEGQICNFDGTTLVQGHRNPWEIVTGE
IYPKMADNARLSWGLENNIYNLGHRGYVAKPGGEHDAGLTYIKDLAAGKYKLPWEDHMKIKDGSIYGYPTTGGRFGK

The query sequence (length=317) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2e2l:A	317	317	1.0000	1.0000	1.0000	0.0	2e2l:C, 2e2l:F
2	4gyl:A	340	284	0.3186	0.2971	0.3556	1.97e-54	4gyn:A, 4kzf:A
3	6ypa:B	269	229	0.2019	0.2379	0.2795	1.14e-10	7ovg:A, 7ovg:B, 6ypa:A, 6ypa:C, 6ypa:D
4	3klc:A	261	226	0.1924	0.2337	0.2699	8.40e-10	3klc:B
5	8hpc:C	303	304	0.2334	0.2442	0.2434	3.03e-08	8hpc:A, 8hpc:B, 8hpc:D, 8hpc:E, 8hpc:F, 8hpc:G, 8hpc:H, 1uf5:A, 1uf5:B, 1uf7:A, 1uf7:B, 1uf8:A, 1uf8:B
6	5h8i:C	301	205	0.1735	0.1827	0.2683	5.44e-06	5h8i:B, 5h8i:D, 5h8i:E, 5h8i:F, 5h8i:G, 5h8i:J, 5h8i:K, 5h8i:L, 5h8i:M, 5h8i:N, 5h8i:O, 5h8j:B, 5h8j:C, 5h8j:D, 5h8j:E, 5h8j:F, 5h8j:G, 5h8j:J, 5h8j:K, 5h8j:L, 5h8j:M, 5h8j:N, 5h8j:O, 5h8l:B, 5h8l:C, 5h8l:D, 5h8l:E, 5h8l:F, 5h8l:G, 5h8l:J, 5h8l:K, 5h8l:L, 5h8l:M, 5h8l:N, 5h8l:O
7	4izt:A	263	159	0.1230	0.1483	0.2453	1.10e-04	4izs:A, 4izu:A, 4izv:A, 4izw:A, 5ny7:A, 5nyb:A, 5nyc:A, 5nye:A
8	8uxu:A	317	136	0.1104	0.1104	0.2574	0.003	8uxu:B, 8uxu:C, 8uxu:D, 8uxu:E, 8uxu:F, 8uxu:G, 8uxu:H, 8uxu:I, 8uxu:J, 8uxu:K, 8uxu:L, 8uxu:M, 8uxu:N
9	5k61:A	431	98	0.0820	0.0603	0.2653	0.008	5b62:A, 5k60:A, 5k62:A, 5k63:A, 5k66:A
10	4cyg:A	463	114	0.0852	0.0583	0.2368	0.095	4cyg:B, 7slv:A, 7slx:A, 7sly:A
11	5kha:A	526	111	0.0978	0.0589	0.2793	0.10	5kha:B
12	4hg3:A	304	125	0.0978	0.1020	0.2480	0.31	4hg3:B, 4hg3:C, 4hg3:D, 4hg5:A, 4hg5:B, 4hg5:C, 4hg5:D, 4hgd:A, 4hgd:B, 4hgd:C, 4hgd:D
13	5epe:A	248	73	0.0694	0.0887	0.3014	1.5
14	2wop:A	554	49	0.0442	0.0253	0.2857	2.5	2wok:A
15	3wrg:A	658	53	0.0536	0.0258	0.3208	3.6	7bzl:A, 7dif:A, 7exu:A, 7exv:A, 7exw:A, 8qf2:A, 3wkx:A, 3wre:A
16	7f5m:A	139	56	0.0568	0.1295	0.3214	6.2	7f5m:B
17	1v33:A	346	78	0.0568	0.0520	0.2308	6.9	1v34:A
18	5ceo:A	269	29	0.0379	0.0446	0.4138	8.0	5cep:A, 5ceq:A, 8deg:A, 8our:A, 8ous:A, 8out:A, 5vo1:A, 5vo2:A
19	2r6f:B	879	88	0.0757	0.0273	0.2727	9.2

[Back]