GFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIAEWDSQHGELEGYRASDGQHLGSFDPKTG
NQLKGPDPKRNIKKYL
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4v5k:AY | 97 | 96 | 0.9792 | 0.9691 | 0.9792 | 8.18e-64 | 4udm:B |
2 | 2qpz:A | 103 | 37 | 0.1667 | 0.1553 | 0.4324 | 1.3 | |
3 | 7jvi:A | 421 | 31 | 0.1042 | 0.0238 | 0.3226 | 2.0 | 7jvi:B |
4 | 7wae:B | 877 | 38 | 0.1354 | 0.0148 | 0.3421 | 3.4 | 7wad:A, 7wad:B, 7wad:C, 7wad:D, 7wae:D, 7wae:A, 7wae:C, 7waf:A, 7waf:C, 7waf:D, 7waf:B |
5 | 2h2n:A | 317 | 38 | 0.1562 | 0.0473 | 0.3947 | 4.4 | 2h2n:B, 2h2u:A, 2h2u:B, 1s18:A, 1s18:B, 1s1d:A, 1s1d:B |
6 | 6j0k:A | 191 | 21 | 0.0938 | 0.0471 | 0.4286 | 4.7 | 6j0g:A, 6j0g:B, 6j0g:C, 6j0g:D, 6j0k:B |
7 | 7cpx:A | 2262 | 16 | 0.0938 | 0.0040 | 0.5625 | 7.3 | 7cpx:B, 7cpy:A, 7cpy:B |