BioLiP

>protein
GFGGFGMSVYTPKKDRRFRVQPLPSLHANSLADDTPLVTTTRTLSPNFRAFALQDGGVFFTHPSHEQVMRVGQNILAEET
KATGMTSMDTYVNSRIQSIIAENTVENVALSHWRRRHMWNLVRTHGKLQRHWGVSDATK

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6yxx:Af	139	139	1.0000	1.0000	1.0000	1.92e-103	7aoi:Af, 6hiv:Af, 6hix:Af, 6yxy:Af
2	7aih:Aa	178	144	0.5971	0.4663	0.5764	6.96e-55	7am2:Aa, 7ane:Aa
3	6zca:Y	1127	130	0.2014	0.0248	0.2154	1.1	6zfb:Y, 6zfb:y
4	6wvk:D	1184	130	0.2014	0.0236	0.2154	1.2	6wvj:D
5	5ltx:A	243	49	0.1079	0.0617	0.3061	1.4	5ltx:B, 5t65:A, 5t65:B, 5t7m:A, 5t7m:B
6	5ovt:A	183	72	0.1367	0.1038	0.2639	2.1	5ovt:B, 5ovt:C, 5ovt:D, 5ovt:E, 5ovt:F, 5ovt:G
7	2whd:B	319	89	0.1871	0.0815	0.2921	2.6	2whd:A
8	2dq0:A	447	50	0.1223	0.0380	0.3400	2.9	2dq0:B, 2zr2:A, 2zr2:B
9	5lt9:B	253	51	0.1007	0.0553	0.2745	5.6	5lt9:A, 5lto:A, 5lto:B
10	4q86:B	583	53	0.1079	0.0257	0.2830	6.6	4q85:A, 4q85:B, 4q85:C, 4q85:D, 4q85:E, 4q85:G, 4q85:H, 4q86:A, 4q86:C, 4q86:D, 4q86:E, 4q86:G, 4q86:H
11	3dbj:A	160	82	0.1583	0.1375	0.2683	7.8	3dbj:C, 3dbj:E, 3dbj:G
12	6x32:B	3798	42	0.0935	0.0034	0.3095	8.9	6x32:E, 6x32:H, 6x32:K
13	2f7v:A	360	29	0.0719	0.0278	0.3448	9.3
14	2w16:B	754	69	0.1151	0.0212	0.2319	9.7	2iah:A, 2w6t:B, 2w6u:B, 2w76:B, 2w77:B, 2w78:B, 1xkh:A, 1xkh:B, 1xkh:C

[Back]