GERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQT
The query sequence (length=40) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2mqv:A | 56 | 40 | 1.0000 | 0.7143 | 1.0000 | 2.42e-24 | 1a6b:B, 2ms0:A, 2ms0:C, 2ms1:A, 1u6p:A, 1wwd:A, 1wwe:A, 1wwf:A, 1wwg:A |
2 | 8opp:A | 670 | 21 | 0.2500 | 0.0149 | 0.4762 | 0.025 | |
3 | 8opt:A | 783 | 26 | 0.2750 | 0.0140 | 0.4231 | 0.036 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
4 | 7c4c:A | 332 | 20 | 0.2250 | 0.0271 | 0.4500 | 0.47 | 7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A |
5 | 7b9v:c | 37 | 19 | 0.2750 | 0.2973 | 0.5789 | 0.65 | |
6 | 5w0n:A | 379 | 17 | 0.2000 | 0.0211 | 0.4706 | 1.1 | 5w0m:A, 5w0m:C, 5w0n:B |
7 | 5w0b:A | 334 | 15 | 0.2000 | 0.0240 | 0.5333 | 1.3 | |
8 | 1p9b:A | 424 | 26 | 0.2500 | 0.0236 | 0.3846 | 1.4 | |
9 | 6bk8:O | 229 | 19 | 0.2750 | 0.0480 | 0.5789 | 1.8 | |
10 | 6exn:c | 204 | 19 | 0.2750 | 0.0539 | 0.5789 | 1.9 | |
11 | 2ihx:A | 50 | 28 | 0.2750 | 0.2200 | 0.3929 | 2.3 | |
12 | 5yzg:y | 112 | 27 | 0.2500 | 0.0893 | 0.3704 | 3.5 | 8i0w:z |
13 | 8sk0:B | 330 | 27 | 0.2250 | 0.0273 | 0.3333 | 3.9 | 8shh:A, 8shh:B, 8sk0:A |
14 | 7sj3:A | 274 | 21 | 0.2750 | 0.0401 | 0.5238 | 5.4 | 5fwk:K, 6p8e:B |