GELDLPERNLDRRELRDLVNELAAHPERWAEHVMFPHYASLHRDAYVDVWLLCWRAEDDTGWHDHDISSGAVRVVAGALK
The query sequence (length=148) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8qfn:A |
155 |
153 |
1.0000 |
0.9548 |
0.9673 |
1.78e-104 |
8qfl:A, 8qfl:B, 8qfm:A, 8qfm:B, 8qfn:B, 8qfo:A, 8qfo:B, 8qfp:A, 8qfp:B, 8qfq:A, 8qfq:B, 8qfr:A, 8qfr:B |
2 |
3eqe:A |
156 |
94 |
0.1959 |
0.1859 |
0.3085 |
6.53e-06 |
3eqe:B, 4qm8:A, 4qm8:B, 4qm9:A, 4qm9:B |
3 |
6bgf:A |
188 |
133 |
0.2162 |
0.1702 |
0.2406 |
0.002 |
2atf:A, 2b5h:A, 6bgm:A, 6bpr:A, 6bps:A, 6bpt:A, 6bpu:A, 6bpv:A, 6bpw:A, 6bpx:A, 6cdh:A, 6cdn:A, 6e87:A, 5efu:A, 3eln:A, 5ezw:A, 2gh2:A, 5i0r:A, 5i0s:A, 5i0t:A, 5i0u:A, 2ic1:A, 4ieo:A, 4iep:A, 4ieq:A, 4ier:A, 4ies:A, 4iet:A, 4ieu:A, 4iev:A, 4iew:A, 4iex:A, 4iey:A, 4iez:A, 4jtn:A, 4jto:A, 4kwj:A, 4kwk:A, 4kwl:A, 6n42:A, 6n43:A, 4pix:A, 4piy:A, 4piz:A, 4pjy:A, 6u1m:A, 6u4l:A, 6u4s:A, 6u4v:A, 4ubg:A, 4ubh:A, 8vl9:D, 8vlb:D, 4xet:A, 4xez:A, 4xf0:A, 4xf1:A, 4xf3:A, 4xf4:A, 4xf9:A, 4xfa:A, 4xfb:A, 4xfc:A, 4xff:A, 4xfg:A, 4xfh:A, 4xfi:A, 4ysf:A, 4yyo:A, 4z82:A |
4 |
5lj5:v |
426 |
96 |
0.1622 |
0.0563 |
0.2500 |
1.1 |
|
5 |
8tz0:A |
505 |
33 |
0.0878 |
0.0257 |
0.3939 |
1.1 |
8tyz:A, 8tz0:B |
6 |
4g09:A |
432 |
50 |
0.1216 |
0.0417 |
0.3600 |
1.5 |
4g07:A |
7 |
6jgz:B |
3485 |
106 |
0.2230 |
0.0095 |
0.3113 |
2.0 |
6jg3:A, 6jg3:B, 6jg3:C, 6jg3:D, 6jgz:D, 6jgz:F, 6jgz:H, 6jh6:B, 6jh6:D, 6jh6:F, 6jh6:H, 6jhn:A, 6jhn:C, 6jhn:E, 6jhn:G, 6ji0:A, 6ji0:C, 6ji0:E, 6ji0:G, 6jrr:A, 6jrr:C, 6jrr:E, 6jrr:G |