Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
GEIILFSGSNHADFKAWGGDDWPSAFEISPKYEPMKLDLNKNFEIKVDYNGADIVLIFARWDKDIWAQISPYYVVDGTAV
FTKEQIAKAYGSDDFSGLDYIAVKPLPSEEGVTVTKVSGIYTNG

The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 5afe:A 124 124 1.0000 1.0000 1.0000 3.67e-88 2ypj:A
2 4afd:A 128 127 0.7419 0.7188 0.7244 1.87e-63
3 7v02:F 650 65 0.1694 0.0323 0.3231 0.084
4 7v00:F 695 65 0.1694 0.0302 0.3231 0.085 7v01:F
5 3ahy:B 466 53 0.1452 0.0386 0.3396 0.32 3ahy:A, 3ahy:C, 3ahy:D
6 6nlx:C 335 56 0.1694 0.0627 0.3750 2.2 6nlx:B, 6nlx:D, 5ur0:A, 5ur0:B, 5ur0:C, 5ur0:D
7 1wkr:A 340 53 0.1210 0.0441 0.2830 2.6
8 5cm7:A 305 59 0.1532 0.0623 0.3220 4.2 5cc8:A, 5cc8:B, 5cm7:B, 5dd7:A, 5dd7:B, 6mfm:A, 6mfm:B
9 4rh7:A 3005 35 0.0887 0.0037 0.3143 4.6
10 6sc2:B 3930 35 0.0887 0.0028 0.3143 4.6 6rla:A, 6rla:B, 6sc2:A
11 1a8r:A 221 27 0.0968 0.0543 0.4444 6.4 1a8r:B, 1a8r:C, 1a8r:D, 1a8r:E, 1a8r:F, 1a8r:G, 1a8r:H, 1a8r:I, 1a8r:J, 1a8r:K, 1a8r:L, 1a8r:M, 1a8r:N, 1a8r:O, 1a9c:A, 1a9c:B, 1a9c:C, 1a9c:D, 1a9c:E, 1a9c:F, 1a9c:G, 1a9c:H, 1a9c:I, 1a9c:J, 1a9c:K, 1a9c:L, 1a9c:M, 1a9c:N, 1a9c:O, 1fbx:A, 1fbx:B, 1fbx:C, 1fbx:D, 1fbx:E, 1fbx:F, 1fbx:G, 1fbx:H, 1fbx:I, 1fbx:J, 1fbx:K, 1fbx:L, 1fbx:M, 1fbx:N, 1fbx:O, 1n3r:A, 1n3r:E, 1n3r:B, 1n3r:C, 1n3r:D, 1n3r:F, 1n3r:J, 1n3r:G, 1n3r:H, 1n3r:I, 1n3r:K, 1n3r:O, 1n3r:L, 1n3r:M, 1n3r:N, 1n3s:A, 1n3s:E, 1n3s:B, 1n3s:C, 1n3s:D, 1n3s:F, 1n3s:J, 1n3s:G, 1n3s:H, 1n3s:I, 1n3t:F, 1n3t:J, 1n3t:G, 1n3t:H, 1n3t:I, 1n3t:K, 1n3t:O, 1n3t:L, 1n3t:M, 1n3t:N, 1n3t:A, 1n3t:E, 1n3t:B, 1n3t:C, 1n3t:D
12 3o0h:B 459 24 0.1048 0.0283 0.5417 7.4 3o0h:A
13 2mxf:A 47 27 0.0887 0.2340 0.4074 7.8
14 3e5r:O 336 25 0.0887 0.0327 0.4400 8.0 3e5r:A, 3e5r:B, 3e5r:C, 3v1y:O, 3v1y:A, 3v1y:B, 3v1y:C

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218