GEFMLTTLIYRSQVHPDRPPVDLDALVHRASSKNLPLGITGILLFNGLQFFQVLEGTEEALESLFSEIQSDPRHRDVVEL
MRDYSAYRRFHGTGMRILDLRLFETDGALEEILRFSTFGVTEPVNDRMFRLLSAFIADGGRYCLPEPL
The query sequence (length=148) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3gfy:B | 374 | 145 | 0.9797 | 0.3877 | 1.0000 | 5.05e-102 | 3gfy:A |
2 | 3gfx:B | 394 | 145 | 0.9797 | 0.3680 | 1.0000 | 8.25e-102 | 3gfx:A, 3gfz:A, 3gfz:B, 3gg0:A, 3gg0:B, 3gg1:A, 3gg1:B, 2kb2:A |
3 | 2byc:A | 137 | 94 | 0.2568 | 0.2774 | 0.4043 | 1.04e-17 | 2byc:B |
4 | 2bun:A | 121 | 93 | 0.2297 | 0.2810 | 0.3656 | 5.99e-11 | |
5 | 2hfo:A | 150 | 121 | 0.2500 | 0.2467 | 0.3058 | 2.93e-10 | 2hfn:A, 2hfn:B, 2hfn:C, 2hfn:D, 2hfn:E, 2hfn:F, 2hfn:G, 2hfn:H, 2hfn:I, 2hfn:J, 2hfo:B, 2hfo:C, 2hfo:D, 2hfo:E, 2hfo:F, 2hfo:G, 2hfo:H, 2hfo:I, 2hfo:J, 3mzi:A, 3mzi:B, 3mzi:C, 3mzi:D, 3mzi:E, 3mzi:F |
6 | 4hh0:A | 383 | 93 | 0.2230 | 0.0862 | 0.3548 | 6.63e-09 | 4hh0:B, 4hh1:A, 4hh1:B, 2iyg:A, 2iyg:B, 2iyi:A, 2iyi:B, 1yrx:A, 1yrx:B, 1yrx:C |
7 | 6w6z:A | 151 | 79 | 0.1959 | 0.1921 | 0.3671 | 8.77e-08 | 6w72:A, 6w72:B |
8 | 8i98:F | 143 | 115 | 0.2095 | 0.2168 | 0.2696 | 3.15e-07 | 8i98:A, 8i98:B, 8i98:C, 8i98:D, 8i98:E, 8i98:G, 8i98:H, 8i98:I, 8i98:J, 8i98:K, 8i98:L, 8i98:M, 8i98:N, 8i98:O, 8i98:P, 8i98:Q, 8i98:R, 8i98:S, 8i98:T, 1x0p:A, 1x0p:B, 1x0p:C, 1x0p:D, 1x0p:E, 1x0p:F, 1x0p:G, 1x0p:H, 1x0p:I, 1x0p:J |
9 | 5m2a:A | 346 | 99 | 0.1892 | 0.0809 | 0.2828 | 1.31e-06 | 5m27:A, 5m27:B, 5m2a:B, 5mbb:A, 5mbb:B, 5mbc:A, 5mbc:B, 5mbd:A, 5mbd:B, 5mbe:A, 5mbe:B, 5mbh:A, 5mbj:A, 5mbk:A, 5nby:A |
10 | 4yut:A | 351 | 80 | 0.1689 | 0.0712 | 0.3125 | 2.18e-06 | 8qfe:A, 8qff:A, 8qfg:A, 8qfh:A, 8qfi:A, 8qfj:A, 5x4t:A, 5x4u:A, 5x4v:A, 4yus:A, 4yut:B |
11 | 8csz:D | 494 | 33 | 0.0946 | 0.0283 | 0.4242 | 1.8 | |
12 | 8fzi:v | 525 | 52 | 0.1081 | 0.0305 | 0.3077 | 2.9 | 8fzd:v, 8fzf:v, 8fzg:v, 8fzj:v, 6gwt:w, 6gxm:w, 6gxn:w, 6gxo:w, 6gxp:w, 2h5e:A, 2h5e:B, 6lkq:v, 7m5d:7, 4v85:AW, 4v89:AW, 4v8o:AY |
13 | 8ctl:D | 401 | 33 | 0.0946 | 0.0349 | 0.4242 | 3.1 | 7utn:D, 7xht:A |
14 | 3iup:A | 376 | 106 | 0.1824 | 0.0718 | 0.2547 | 7.9 | 3iup:B |