GEATTIWGVGADEAIDKGTPSKNDLQNMSADLAKNGFKGHQGVACSTVKDGNKDVYMIKFSLAGGSNDPGGSPCSDD
The query sequence (length=77) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1kvd:B | 77 | 77 | 1.0000 | 1.0000 | 1.0000 | 2.62e-52 | |
2 | 1xdn:A | 265 | 63 | 0.2338 | 0.0679 | 0.2857 | 2.0 | |
3 | 4b21:A | 207 | 41 | 0.1429 | 0.0531 | 0.2683 | 2.8 | 4b22:A, 4b23:A, 4b24:A, 4hsb:A |
4 | 7rwk:A | 368 | 30 | 0.1558 | 0.0326 | 0.4000 | 4.2 | 7rwk:B |
5 | 2xfg:B | 172 | 65 | 0.2338 | 0.1047 | 0.2769 | 4.5 | |
6 | 8bah:A | 399 | 24 | 0.1169 | 0.0226 | 0.3750 | 4.8 | 8bah:B, 3t1i:A, 3t1i:B, 3t1i:C, 3t1i:D |
7 | 5b0s:B | 355 | 23 | 0.1299 | 0.0282 | 0.4348 | 6.3 | 5b0q:A, 5b0q:B, 5b0r:A, 5b0r:B, 5b0s:A |
8 | 5bp9:A | 237 | 40 | 0.1688 | 0.0549 | 0.3250 | 7.1 | |
9 | 8gme:A | 267 | 26 | 0.1558 | 0.0449 | 0.4615 | 8.3 | 2a1k:A, 2a1k:B, 2atq:B, 8gme:B, 1gpc:A |
10 | 4ews:A | 472 | 31 | 0.1688 | 0.0275 | 0.4194 | 9.6 | 4f2a:A, 2obd:A |