BioLiP

>protein
GDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKL

The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6mif:A	79	70	1.0000	0.8861	1.0000	1.04e-46
2	7lt9:B	131	70	1.0000	0.5344	1.0000	7.17e-46	7d2s:B, 7d2t:B, 7d2t:D, 7d2u:B, 1nyp:A, 1u5s:B
3	7lt9:B	131	57	0.2857	0.1527	0.3509	0.002	7d2s:B, 7d2t:B, 7d2t:D, 7d2u:B, 1nyp:A, 1u5s:B
4	1v6g:A	81	56	0.3286	0.2840	0.4107	2.13e-07
5	2dar:A	90	57	0.3286	0.2556	0.4035	2.57e-07
6	1x3h:A	80	55	0.2571	0.2250	0.3273	8.50e-06
7	7qb0:A	127	55	0.2857	0.1575	0.3636	3.05e-05
8	7qb0:A	127	53	0.2714	0.1496	0.3585	0.001
9	2cur:A	69	56	0.2429	0.2464	0.3036	6.94e-05
10	2dj7:A	80	50	0.2429	0.2125	0.3400	1.89e-04
11	1x61:A	72	47	0.2429	0.2361	0.3617	2.32e-04
12	2d8x:A	70	55	0.2429	0.2429	0.3091	6.09e-04
13	6u4m:A	65	58	0.2714	0.2923	0.3276	0.001	6u4n:B
14	2cuq:A	80	56	0.2000	0.1750	0.2500	0.010
15	1x64:A	89	47	0.2571	0.2022	0.3830	0.15
16	1b8t:A	192	58	0.2429	0.0885	0.2931	0.16	1ctl:A
17	1cxx:A	59	51	0.2286	0.2712	0.3137	0.20	1ibi:A, 1qli:A
18	6cme:A	154	60	0.2857	0.1299	0.3333	0.25	6cme:B, 3mmk:A, 3mmk:B
19	2xqn:T	125	56	0.2714	0.1520	0.3393	0.27	2iyb:E, 2iyb:F, 2iyb:G, 2iyb:H
20	1x4k:A	72	39	0.1857	0.1806	0.3333	0.69
21	2mbv:A	96	44	0.1857	0.1354	0.2955	0.75
22	2o13:A	58	56	0.2571	0.3103	0.3214	0.84
23	2d8z:A	70	53	0.2000	0.2000	0.2642	0.89
24	2jtn:A	182	44	0.2143	0.0824	0.3409	1.1
25	2jtn:A	182	37	0.1429	0.0549	0.2703	6.3
26	7p0h:A	411	38	0.1714	0.0292	0.3158	1.3	7p0h:B, 7p0h:C, 7p0h:D
27	2rgt:B	154	44	0.2143	0.0974	0.3409	1.5	2rgt:A
28	2rgt:B	154	37	0.1429	0.0649	0.2703	6.9	2rgt:A
29	2dfy:X	158	53	0.2000	0.0886	0.2642	1.5	2dfy:C, 1rut:X
30	2d8y:A	91	58	0.2143	0.1648	0.2586	1.9
31	2dlo:A	81	34	0.1571	0.1358	0.3235	1.9
32	1wyh:A	72	38	0.1857	0.1806	0.3421	1.9
33	2cup:A	101	54	0.2714	0.1881	0.3519	3.0
34	7aih:Ax	167	66	0.2429	0.1018	0.2576	4.0	7am2:Ax, 7ane:Ax
35	1iri:A	557	18	0.1286	0.0162	0.5000	6.1	1dqr:A, 1dqr:B, 1g98:A, 1g98:B, 1gzv:A, 1hox:A, 1hox:B, 1iri:B, 1iri:C, 1iri:D, 1koj:A, 1koj:B, 1nuh:A, 1xtb:A, 1xtb:B, 6xuh:A, 6xuh:B, 6xuh:C, 6xuh:D, 6xui:A, 6xui:B, 6xui:C, 6xui:D
36	2o4u:X	331	37	0.1857	0.0393	0.3514	6.1	2poq:X
37	4hea:3	756	36	0.1857	0.0172	0.3611	6.2	2fug:3, 2fug:C, 2fug:L, 2fug:U, 4hea:D, 6i0d:3, 6i0d:D, 6i1p:3, 6i1p:D, 3i9v:3, 3i9v:C, 3iam:3, 3iam:C, 3ias:3, 3ias:C, 3ias:L, 3ias:U, 3m9s:3, 3m9s:C, 6q8o:3, 6q8o:D, 6q8w:3, 6q8w:D, 6q8x:3, 6q8x:D, 6y11:3, 6y11:D, 2ybb:3, 6ziy:3, 6zjl:3, 6zjn:3, 6zjy:3
38	2lxd:A	123	35	0.1000	0.0569	0.2000	6.2	2l6y:B, 2l6z:C
39	4b0a:A	237	29	0.1286	0.0380	0.3103	6.7
40	2miu:A	98	58	0.2429	0.1735	0.2931	8.5
41	3ab3:A	322	26	0.1286	0.0280	0.3462	8.8	3ab3:C, 3cx6:A, 3cx7:A, 3cx8:A, 1zcb:A
42	1x62:A	79	46	0.1857	0.1646	0.2826	9.3
43	7w16:A	264	59	0.2143	0.0568	0.2542	9.9

[Back]