GDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLEHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRG
TGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRIALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSN
ARYVSQQTRANPNPYTS
The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7skk:D | 181 | 180 | 0.9944 | 0.9724 | 0.9778 | 1.23e-126 | 7ski:A, 7ski:B, 7skk:A, 7skk:B, 7skk:C, 7sky:B, 7sky:A, 7sky:C, 7sky:D, 7sne:A, 7sne:B, 7sne:C, 7sne:D, 7u6z:B, 7u6z:A |
2 | 4z9d:C | 175 | 181 | 0.3277 | 0.3314 | 0.3204 | 3.03e-16 | 4z9d:A, 4z9d:B, 4z9d:D |
3 | 5h6j:B | 222 | 59 | 0.0960 | 0.0766 | 0.2881 | 1.6 | 5h6j:A, 5h6l:A, 5h6l:B |
4 | 8qre:A | 237 | 63 | 0.1130 | 0.0844 | 0.3175 | 3.0 | 2a5f:B |
5 | 5zj5:A | 160 | 21 | 0.0678 | 0.0750 | 0.5714 | 4.6 | 5zj5:B |
6 | 4xqm:A | 94 | 74 | 0.1243 | 0.2340 | 0.2973 | 8.0 |